6G18


Conserved Protein Domain Family
Bystin

?
pfam05291: Bystin 
Bystin
Trophinin and tastin form a cell adhesion molecule complex that potentially mediates an initial attachment of the blastocyst to uterine epithelial cells at the time of implantation. Trophinin and tastin bind to an intermediary cytoplasmic protein called bystin. Bystin may be involved in implantation and trophoblast invasion because bystin is found with trophinin and tastin in the cells at human implantation sites and also in the intermediate trophoblasts at invasion front in the placenta from early pregnancy. This family also includes the yeast protein ENP1. ENP1 is an essential protein in Saccharomyces cerevisiae and is localized in the nucleus. It is thought that ENP1 plays a direct role in the early steps of rRNA processing as enp1 defective yeast cannot synthesize 20S pre-rRNA and hence 18S rRNA, which leads to reduced formation of 40S ribosomal subunits.
Statistics
?
PSSM-Id: 398790
Aligned: 89 rows
Threshold Bit Score: 330.619
Threshold Setting Gi: 123491805
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6G18_WW      144 RRTLADIIMEKLTEKQTEVE-TVMSEV--------SGFpMPQLDPRVLEVYRGVREVLSKYRSGKLPKAFKIIPA--LSN 212
CBJ32010     104 RRSLADIIMEKIREKEEGETrAAGMGGgg----deDEDgMPRLPPKVVEVYGAIGKMLKSYTAGKLPKAFKIIPS--LTN 177 Ectocarpus sili...
XP_004351477 206 rFTLGQLIEAKLKEQEEKES-MV-------------KEpRQKMNPKVLEVYKKVGQMLAHYRSGKVPRAFCILPN--FTN 269 Cavenderia fasc...
Q54IS0       182 RFTLGDIIESKLKEHESRQV-----------------SsENAINPKVIDVYTKVGKLLETYTSGKIPRAFRILPN--FTN 242 Dictyostelium d...
ESS31277     144 APTLADFILEKLRQKEERES-SGAAAEa-------PEEdCSALPPKVVEVYTAMGSFLQKYRSGKMPKAFKVLPR--LQR 213 Toxoplasma gond...
XP_001325919 101 AKQLFELFKADVVQTSNKLN-STLEKTah------------isDQSVVEIYQKLGVLLRNYKSGKLPKAINVIASqnIPD 167 Trichomonas vag...
A0DVD2       145 TNQIIEDFQKGLQDDENKKH-----------------HeNIMNNPKVVCVYENVAELMKTYRSGKLPQPFHLIPK--LEH 205 Paramecium tetr...
Q8IIR2       133 SKDIFEELNIKIMNDSKHVSyNKMENTtq----epNPStEDKVNLLVEKCYRTIGEDLAHYKSGKLHRALTILTK--SSK 206 Plasmodium falc...
EFJ50348     168 QTSLADLILARLKEQQAERG-LPQLPEegadpgadPGPlPEGLEPRVVEVYRGVGKLLSRYTTGKIPKAFKIIPN--LRN 244 Volvox carteri ...
EFN54310     145 QRTLADLVLERIREKQAEQG-VSEIPRe------gQEFvPDELDPKVVEVYQGVGKVLSRYTAGKVPKAFKVIPN--LQN 215 Chlorella varia...
6G18_WW      213 WEQILYVTEPEA------------WTAAAMYQATRIFASNlKERMAQRFYNLVLLPRVRDDVAEYKRLNFHLYMALKKAL 280
CBJ32010     178 WEQVLWLTRPEQ------------WSSHAMLAATKIFASNfNAKMAQRFYNVFLLEACRTDILENRRLNYHLYEALRKSV 245 Ectocarpus sili...
XP_004351477 270 WEDLIYLTRPDL------------WTPHAVREATKIFVMSsNARQTQRFLSLVLLPRVRDNIAEFRKLNFHLYMALKKSL 337 Cavenderia fasc...
Q54IS0       243 WEDLLYLTRPDK------------WTPHSIRVATKLFCMStNSKITQRFLSIVVLPRVRDNIAEYKKLNYHLYMALKKSL 310 Dictyostelium d...
ESS31277     214 WEEVLLLTQPES------------WSRQAMFEATKIFTSNlSSAGAQRFLCLVLLPAVRSDISTNKKLNYHLYQALKKAL 281 Toxoplasma gond...
XP_001325919 168 WFELLQYSEPEN------------WSANAIKEVTTLFAQTsSEARCNKFYREVLLEYIKNLLDDNKKLPRNVWDALVAAA 235 Trichomonas vag...
A0DVD2       206 WKQVFELTKPSE------------WSPQAIFAATKIFSSAlDRQQTEYLYSTVILPAIRLSIQEDKRLNVHLYNALIKAM 273 Paramecium tetr...
Q8IIR2       207 WYEYLLLTKPKK------------WTAHATFEITKLFSSGlKEKEVSKFYEFILLPIVLENIDKNKKLDAFLYKALIKAL 274 Plasmodium falc...
EFJ50348     245 WEDVLYLTDPGKdfrssvnqnrysWSVHAMYQASRLFVSNlNARLAQRFLALVLLPRVRAEIRQHKRLHFALFQALRKAT 324 Volvox carteri ...
EFN54310     216 WEEILYLTDPDN------------WTPHAVYQATRMFVSNlNQKMSQRFLVLVLLPHVRADIRKNRRLHFALFMALKKAT 283 Chlorella varia...
6G18_WW      281 FKPGAWFKGILIPLCESGTCTLREAIIVGSIITKCSIPVLHSSAAMLKIAEM---EYSGANSIFLRLLLDKKYALPYRVL 357
CBJ32010     246 YKPAAFYKGMLLPLASAGDCTLREAAIFASVLSRVTIPANHSAVALLKLAQL---PYNGATSLFIRVLLNKKYALPYKVI 322 Ectocarpus sili...
XP_004351477 338 YRPQAFYKAIFLPLAEEGDATLLEAKIIASVVKKVSVPVIHSSVALLKLAQIp--KYNGATSLFIMTLCDKKYSLPLRVV 415 Cavenderia fasc...
Q54IS0       311 YRPAAFYKAILLPLAESGDCTLLEAKIIGSVVCKVSIPVLHSSVALMKLSQLt--RYNGATSMFIRMLCDKKYALPYRVI 388 Dictyostelium d...
ESS31277     282 FKPAAFFKGIFLPLALEG-CSNREAIIVGSVVAKVSIPVLHAAAALMRLALVpppQWLPAVSVLMGLLINKKYSLPVKAV 360 Toxoplasma gond...
XP_001325919 236 RRPKPFILALMMPLAAQDNCSPKDARVISAMVNRVKLPNDLVNSFLVWLCEGk--PITLPRTIFVIRFVQKGKVLAIRAV 313 Trichomonas vag...
A0DVD2       274 YKPQAWFRSILFPLCLEKDFTLKEAQIIGSVIHKLHVPPIHGSIAIFKVAQL---DFTGPVAVILKVLIEKKFSLPERAL 350 Paramecium tetr...
Q8IIR2       275 YKSKSWFKGILFPIL-HRECTKKQMIIIGSVIQKMSISINCVVLALDEIFSF---SWNSIISYILILLFNKKYAFTKQCI 350 Plasmodium falc...
EFJ50348     325 YKPGAFYKGILLPLCQSRTCTLREAVILTSVLKRASLPVLHSAAALLRLAQL---EYCGTTSFFMRVLLDKKYALPYRVI 401 Volvox carteri ...
EFN54310     284 YKAAAFYKGVLLPLCASGTCNLREAVILTSVIKRTSIP-------------M---PYSGTNSFFLRVLLDKRYALPYRVV 347 Chlorella varia...
6G18_WW      358 DALVFHFLGFRTEkrELPVLWHQCLLTLVQRYKADLATDQKEALL-ELLRLQPHPQLSPEIRRELQSAVPRDVED 431
CBJ32010     323 DSLVDHFMTFTTEtrVLPVLWHQSLLVFAQRYRGDITRADKDRLK-ELLKAQQHHQITPEVRRQLFMGSCRGEPk 396 Ectocarpus siliculosus
XP_004351477 416 DSLYQHFISFVDErrDLPVLWHQSLLMFVQRYKNDIKPQHKENLK-ILLRNQFHHQITNEIRRELFNNQSSQQSE 489 Cavenderia fasciculata
Q54IS0       389 DGLVDHFVMFDEEvrELPVLWHRALLSFVQRYKTDITKDQKEKLK-IILRKHNHHIITAEIRRELFFSNSRGGVA 462 Dictyostelium discoi...
ESS31277     361 QACVAHFHRFAERadlLPVAWHQALLVFVQRYKFCLSEDERSMLK-EVLRVHFHEKIGPEIRRELLAKQAALVLQ 434 Toxoplasma gondii VEG
XP_001325919 314 DAVYGYFMQFAAEteqQPVIWHKALKDFAKHYARDLTQEQKEIMVgDLLQKQHKSGITPEIREIIMKSPTREega 388 Trichomonas vaginali...
A0DVD2       351 DEVIKYFMRYENDqrEMPVIWHQMILRVCELYQ--LKQDHKDQLK-KLINKKKHHLITKEIQKQLKQRHQNGCRK 422 Paramecium tetraurelia
Q8IIR2       351 DNCVNYFLRFENYqdvLSINWHKSLLTLVHNYRGLMCDTQVEALT-HLVKKKNHHQISSEIMKHLYSPTSLMNKG 424 Plasmodium falciparu...
EFJ50348     402 DALVDHFVRFADDerQMPVVWHQTMLCFVQRYKHEVRADDLLALR-ALCGKQHHYKVTPEVLRELDHALGRGgaa 475 Volvox carteri f. na...
EFN54310     348 DALVDHFLRFKTEerQLPVVWQQTLLCFVQRYKTEIRREDKHALR-DLVKRQHHYALTPAILRELDSSLSRGEQA 421 Chlorella variabilis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap