2AVU


Conserved Protein Domain Family
FlhC

?
pfam05280: FlhC 
Flagellar transcriptional activator (FlhC)
This family consists of several bacterial flagellar transcriptional activator (FlhC) proteins. FlhC combines with FlhD to form a regulatory complex in E. coli, this complex has been shown to be a global regulator involved in many cellular processes as well as a flagellar transcriptional activator.
Statistics
?
PSSM-Id: 398786
Aligned: 34 rows
Threshold Bit Score: 213.606
Threshold Setting Gi: 120606004
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2AVU_E              3 EKSIVQEARDIQLAMELITLGARLQMLESETQLSRGRLIKLYKELRGSPPPKGMLPFSTDWFMTWEQNVHASMFCNAWQF 82 
Q3SJG7              3 KKSLLTEMRDTQLAIELIELGARPQVLEAETSLSRERLLKLYKEVKGVSPPKGMLPFSTDWFLTWLPNVHASLFMNIHGY 82  Thiobacill...
Q2Y9G2              3 KKSIVSEANEIKTAIELIRLGARLQLLESETTLSRERLIKLYKELKGVSPPKGMLPFSTDWFLTWQPNIHSSVFADIYRY 82  Nitrosospi...
bbmufp:Hsero_2988   3 KKSVVTEAQEIQLAIELINLGARLQLLESETSLSRERLLKLYKELKGVSPPKGMLPFSTDWFITWQPNIHSSLFINIHRY 82  Herbaspiri...
WP_013441637        3 KKSVVNEAQQIQLAIQLITLGARLQLLESQTTLSRERLIKLYKELKGVSPPKGMLPFSTDWFLTWQPNIHSSMFLNIYNF 82  Methylovorus
Q1GZX8              2 SKSVINEAEQIQLAIQMIHLGARLQLLESQTTLSRERLIKLYKEIKGVSPPKGMLPFSTDWFLTWQPNIHSSIFANIYHF 81  Methylobac...
jgi:M301_1692       4 KKSVVNEAEQIQLAIKMIKLGARLQLLESQTTLSRERLIKLYKELKGVSPPKGMLPFSTDWFLTWQPNIHSSIFFNIYKF 83  Methyloten...
CCH:MU9_1756        3 EKSIIKEAQDIRLAMELISLGARLQMLESETQISRGRLIRLYKELRGCPPPKGMLPFSTDWFMTWEQNIHASMFYNAYEF 82  Morganella...
utah:Sant_0124      3 RKSIMQESRDIQLAMELIALGARLPILENETCLSRSRLLRLYKEVKGTPAPKGLLPFSADWFLSWEQNIHSSAFYNAYLC 82  Sodalis pr...
Q6D6J4              3 EKSIVQEAKDIQLAMELISLGARLQMLESETQLSRGRLIKLYKELRGSPPPKGMLPFSTDWFMTWEQNIHSSMFYNAYSF 82  Pectobacte...
2AVU_E             83 LLKTGLCNGVDAVIKAYRLYLEQC-PQA--EEGPLLALTRAWTLVRFVESGLLQLSSCNCCGGNFITHAHQPVGSFACSL 159
Q3SJG7             83 LVRNSECSGIEAMLKSYRLYQEYL-HSN--EIEAVLSFTRAWTLNRFFESRMLATAACTECGGHFVVHPEDLHTHYVCGL 159 Thiobacill...
Q2Y9G2             83 LIAHGDCRGISAIIKSYKLYLEHC-QVC--EMEPILSLTRAWTLVRFFESKLMQTTACNQCGGHFVVHANDLHHRYVCGL 159 Nitrosospi...
bbmufp:Hsero_2988  83 LVEHARISGIEAVMKAYKLYLEQV-GQNd-AGEPVLSLTRAWTLVRFFESKMLMTTPCCKCNGHFVVHRLDLHQDYLCGL 160 Herbaspiri...
WP_013441637       83 MREHTDVNGITAVIKAYQLYLDET-GTEd-PETAVLSLTRAWTLVRFVESKMLKLQACSCCGGHFVVNVYDLNQHFACSL 160 Methylovorus
Q1GZX8             82 LIQHAGVTGITAVMKAYKLYLQQV-GSEphDDDVVLSLTRAWTLIRFLDSNMLKMQRCSCCGGEFVVNAYDLHDSYQCNL 160 Methylobac...
jgi:M301_1692      84 MVDYTDEKGIHAIIKAYSLYLQQV-EQEg-EEEPVLSMTRAWTLVRFVESKMLKMQSCNCCGGSFIVNSYDLNHKYVCNL 161 Methyloten...
CCH:MU9_1756       83 LMNSGQCTGVDVIVKAYRLYLEQCpPAP--GEEPLLALTRAWTLVRFVESGMLQRSVCSCCSGSFVTYAHIPENSFTCSL 160 Morganella...
utah:Sant_0124     83 LIRIGNIPTIEAMIKAYRLYLELCpQRQ--DGGPVLGLTRAWILLRFIDSQLLGQTRCKQCGGAFITYAFHPPHNFVCSF 160 Sodalis pr...
Q6D6J4             83 LIKNGQCSGVEAVIKSYRLYLEQCpP-Q--SDSPLLALTRAWTLVRFVDSGMLQLSSCNCCKGMFITHAHQPKNSFVCSL 159 Pectobacte...
2AVU_E            160 CQPPSRAVKRRKLS 173
Q3SJG7            160 CNMPARAGKTRKAK 173 Thiobacillus denitrificans ATCC 25259
Q2Y9G2            160 CHMPSRAGKTNKAR 173 Nitrosospira multiformis ATCC 25196
bbmufp:Hsero_2988 161 CHMPSRAGKTKKAK 174 Herbaspirillum seropedicae SmR1
WP_013441637      161 CHVPSRAGKTKKTR 174 Methylovorus
Q1GZX8            161 CHVPSRAGKTRKAK 174 Methylobacillus flagellatus KT
jgi:M301_1692     162 CHVPSRAGKTKKAK 175 Methylotenera versatilis 301
CCH:MU9_1756      161 CQPPSRAIKKRKLS 174 Morganella morganii subsp. morganii KT
utah:Sant_0124    161 CHPPSRAVKKRKLS 174 Sodalis praecaptivus
Q6D6J4            160 CQPPSRAVKRRKLS 173 Pectobacterium atrosepticum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap