Conserved Protein Domain Family
CopB

?
pfam05275: CopB 
Copper resistance protein B precursor (CopB)
This family consists of several bacterial copper resistance proteins. Copper is essential and serves as cofactor for more than 30 enzymes yet a surplus of copper is toxic and leads to radical formation and oxidation of biomolecules. Therefore, copper homeostasis is a key requisite for every organism. CopB serves to extrude copper when it approaches toxic levels.
Statistics
?
PSSM-Id: 398784
Aligned: 99 rows
Threshold Bit Score: 178.1
Threshold Setting Gi: 123736063
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CBV41747                   42 SRGSLLIDRLEYTTPdKGEEAL-AWDFRAWYGGDIKR-IYLKGEGENIQgdGKDAEFEnLDLLYSRLIAPFWELQGGIGY 119 Ha...
chanu:ambt_07315           36 NTGMILFDRFEYTRT-NDEENIgVWDMIGWYGGDTYR-LYFKNEGENKQddGEPTDLErAELLASKLIAPFWEFQAGIGT 113 Al...
Q5QUM1                     34 NTGQVLFDRLELTRT-NEEENLaVWDMIAWYGGDYHR-AVFKSEGENVQddGEPTDLErAELLYGYLVSPFWSFQAGIGT 111 Id...
WP_012992236               32 LYGKLLLDRLEYL---PSKKTF-RYDAEFWYGGDFHR-VYIETEGNHSLk-RGDGEIKrADIYIGKLVTPFWTMRLGAGA 105 Th...
WP_012676859               39 yYGQILFDRLEY----DDSKRL-NYEVTSWYGGDYQR-FWIEVEGENNFe-KEEGDLErLDVLYGKLFSPFWDIRAGVGY 111 Pe...
WP_007103506              115 TVSKVIFDQLEYRNG-NNTKLN-RWDMQGWRGTDYEK-FWVKFEGRDIKs-ESGGEFE-VQGLYSKAVSAYWDIQYGARY 189 Ga...
Q6FEA5                     70 IYQATQWDNLWALNR-HGEASI-SSELKSWIGTDENK-VFLKAELEKEQ--SSSPDRY-ISILYSRNIANFWDVQAGVRY 143 Ac...
Q5LKL2                     12 LIYGFQAEQLEYRQG-DSEDSF-VWDFDALIGTDELK-LVWRSEGERVQgaGGFETLE-NQLRLQFPVSTFFDAVVGVQA 87  Ru...
Q0VPT8                     39 TTWGVQFEEFEYRYS-DDDEELgVWNADAFYGTDEFK-VRLLTTGEYEIeeQAYETLE-NQLVGQIPISKFFDAKAGVRF 115 Al...
Academia_Sinica:M5M_13805  21 iefsgeFDQFELRSQ-----GLaLWDAELFIGNAADQaLVIKSTAEIPN--RYLGAHE-AQVLGQMAANDTWTLRAGVRS 92  Si...
CBV41747                  120 QGGIAtdtsPERYFGVINLQGLAPYRFDTDISLRVSDDGDISGSLETEYDIRLTQRLLLQPRLEVAASANDVPEFGIGEG 199 Ha...
chanu:ambt_07315          114 RGLLSsd-tSMENYAVISLYGVAPYQFEMDNSIVINEDGDVSFSVEAEYEIRVTQTSFLQPRLALAGSLSESERFDRPSG 192 Al...
Q5QUM1                    112 RGTLSsd-aSMENYAVVSFMGLAPYWFEMDNSLMVNEEGDVQFVSETEYEWQLTQTSYLQPRIELTANLTDSDKYERQSG 190 Id...
WP_012992236              106 EGEYRh---PFRKYVVVGVEGLAPYWFEVDANMKVDTEGRTSLHMKTYVDLLITQKLVLQPRVEGAYYLRDIPKVSRPAG 182 Th...
WP_012676859              112 RSSYGdg-tKDRKSFVVGLKGLAPYWFEVDTNMRFTTEGELYGDVEAEYDLLFTQRLVFQPRIDTTFSFSDIPEIGVYNG 190 Pe...
WP_007103506              190 DRAYGsgknDERYFGVIGVQGLAPYWFEVEPALFVDSNGKISARIVAAYDLLLSQRLILQPRAEINASASDLPELGIGQG 269 Ga...
Q6FEA5                    144 RDQASqvesKEHLDAVFALHGLAPYFFETDVSLYLGEQQYASLKLETERDILLTQKLILKPYLEADIVLSDQSRDAEKKG 223 Ac...
Q5LKL2                     88 STPDGl---PDRYNAVLGLKGLAPQWFEIDADLYLSDNS--FFRFEGEYEAMLTNRLTLTPSLELTLPLQDDPIYNQAAG 162 Ru...
Q0VPT8                    116 DTPEG----PDRTYAVLGVAGLAPQWFEIDANLYVSKDGDTSAELDAEYELLLTNYWILAATLDATVAFSEDREIGVGKG 191 Al...
Academia_Sinica:M5M_13805  93 DHYPD----PKRHWGVLSALAESDAGTAYEITGFVSPDNQ-GLLLGIEHFWEVAPQWKLIPKAELLFHTEDDIETATGEG 167 Si...
CBV41747                  200 LNSVRTGLRLRYEIS-RKFAPYIGGYWQKSYGNTADIAQDDGEAAEDTGIVAGIRMWY 256 Halomonas elongata DSM 2581
chanu:ambt_07315          193 FNSIRLGLRYRYEFA-REFAPYAGFYWSRSLGNSADIARNKGESVSETGFVVGARFWF 249 Alteromonas naphthaleniv...
Q5QUM1                    191 LSNLRVGLRYRHEIS-REFAPYIGVYWNGALGNTADEMKRMGKDTTETGVVLGARVWF 247 Idiomarina loihiensis
WP_012992236              183 LSRLEAGLRLRYEFR-RELAPYIGLQYSMEKGKEGKK--------EGTHFLLGLRMWF 231 Thermocrinis albus
WP_012676859              191 INNINLSFRLRYELK-REFAPYIGFSYNSFFGDIKDRNGKD----HDLTAFFGVRVWF 243 Persephonella marina
WP_007103506              270 VNDFQLDLRLRYEFK-REIAPYIGITWQKKYGDSAKYSQQQDSSSEFTEVVLGVRIWF 326 Gammaproteobacteria
Q6FEA5                    224 LSTLKSGLQTRYEIN-KKVMPFIDLAYHYKHGQDAQEKTSE----REWLYGAGMTFKF 276 Acinetobacter baylyi
Q5LKL2                    163 GVTLEAGLRLSYDLIdRAVSPYIGVNYERSYGGTADMIRAAGDENGAFSVVFGTRLMF 220 Ruegeria pomeroyi
Q0VPT8                    192 LVSTETGLRLSYDLIdRAFSPYVGVVHERKYGDSADFAEADGGSTADWFAVIGARIal 249 Alcanivorax borkumensis SK2
Academia_Sinica:M5M_13805 168 LSYAEVGLRLRYVAS-PWFKPYVGINWITSHGNTRDFLEQEGARKQNFTYRAGFTWAF 224 Simiduia agarivorans SA1...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap