6RFL


Conserved Protein Domain Family
Pox_RNA_Pol_22

?
pfam05273: Pox_RNA_Pol_22 
Poxvirus RNA polymerase 22 kDa subunit
This family consists of several poxvirus DNA-dependent RNA polymerase 22 kDa subunits.
Statistics
?
PSSM-Id: 398783
Aligned: 9 rows
Threshold Bit Score: 307.814
Threshold Setting Gi: 18202608
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6RFL_E   1 MNQYNVKYLAKILCLKTEIARDPYAVINRNVLLRYTTDIEYNDLVTLITVRHKIDSMKTVFQVFNESSINYTPVDDDYGE 80 
Q9Q905   1 MNPHNVKYLAKILCLKAEIQKNPYAVISKDVVHKYSTDICYGDLTTIIAVHHKTSTSKTVFQVFNESSVNYTPVDDDYGY 80  Rabbit fibroma virus
Q08FS4   1 MNQHNVKYLAKILCLKTEVLRNPYAIISKDILSKYYTEIKYDDLITIITVIHKIDSEKVVFQVFNESSVLYNPVEKDYGY 80  Deerpox virus W-848-83
Q85280   2 MNQYNVTYLSKILCLKTEILYKPFSIINRSIVNQYNIDVKYDDITSIVKIRHKTENTILVFQIFNESNVKYSPIEYDYGD 81  Fowlpox virus strain ...
Q070F4   1 MNSYNVNYMAKVFCLKTEILRDPFAVISSQTLDKYDARVQFGEVVSVITVTNRVDGDPTVYQLFHETVVNYAPKKDDYGE 80  Crocodilepox virus
Q6TVR6   1 MNRHNTRYLAKILCLKAAVRSDPFAVVSRDTVRMYDIKVEYGDLVTVVTVTHKLETSRTVFQVFNETSVAYSPLPDDYGE 80  Orf virus
P68609   1 MNQYNVKYLAKILCLKTEIARDPYAVINRNVLLRYTTDIEYNDLVTLITVRHKIDSMKTVFQVFNESSINYTPVDDDYGE 80  Vaccinia virus WR
Q6TUU6   1 MNNHNVKYLAKILCLKAEITRDPYAIISKEVIFKYETEINYGDLVTIITVKHKIDYSKTVFQVFNESSVTYYPLENDYGE 80  Yaba monkey tumor virus
Q85288   1 MNQHNVEYLAKILCLKAEVARNPYVVVSKELLSRYDVRTRYGDLVTLVRVTHRVDNSTTVFQVFNEAAVSYTPLEHDYGE 80  Molluscum contagiosum...
6RFL_E  81 PIIITSYLQKGHNKFPVNFLYIDVVISDLFPSFVRLDTTETNIVNSVLQTGDGK-Kt-LRLPKMLETEIVVKILYRPNIP 158
Q9Q905  81 PIIITSFLQTGHNKFPISFLYIDVVASDMFPRFARLSPTDIVTVHSVLQIGDTKdV--LKLPRMLETEISAKILFHKDLP 158 Rabbit fibroma virus
Q08FS4  81 PIIITSFLQMGHNKFPAHFLYIDIVASDLFPKFVRLTPDEINIVNSVLQIGDSKdS--LKLPKMLETEISAKILFHKDYP 158 Deerpox virus W-848-83
Q85280  82 PIIITSNLQHGHNRIPINMLYIDVVESDMFPTFSRLDSETIKIITSILQSDNKKeQs-IKLPKVSENELSVKILYHKDYP 160 Fowlpox virus strain ...
Q070F4  81 PMLLTAYKLPEHNKFPMSMTSIDVVASSIFPRFSRPTPSDVSVIECMLMQDDPKsKtrLKLSKMLSTELVCKILYHRDHP 160 Crocodilepox virus
Q6TVR6  81 PIVLTTYMQREHTKFPLSMLYIDVVASDMFPTFKRPTEEEAAVVAAMQRVGGRReAv-LKLPRMLDTELVCKILHLPEHP 159 Orf virus
P68609  81 PIIITSYLQKGHNKFPVNFLYIDVVISDLFPSFVRLDTTETNIVNSVLQTGDGKkT--LRLPKMLETEIVVKILYRPNIP 158 Vaccinia virus WR
Q6TUU6  81 PIIITSLLQTGHNKFPISFLYIDLVASDLFPKFVRLTQDEINIVHSVLQVGDGKeT--LKLPKMLETEVSAKILYRKDIP 158 Yaba monkey tumor virus
Q85288  81 PIIVTAFALPAHNKFPVSALYIDMVASDLFPRFARVDPDTAKVITSLLTPEDRRnEqpVRLPRMLETEVVAKILYHPKVP 160 Molluscum contagiosum...
6RFL_E 159 LKIVRFFRNNMVTGVEIADRSVISV 183
Q9Q905 159 LKIVRFFKHNMVTGEEISDRSLVAV 183 Rabbit fibroma virus
Q08FS4 159 LKIIRFFRNNMVTGLEISDRVLITV 183 Deerpox virus W-848-83
Q85280 161 LKYVRYYKNNMVTGIEVIDRSVAIT 185 Fowlpox virus strain NVSL
Q070F4 161 LKYVRFYKNNRQTGVEVYDRQVMNV 185 Crocodilepox virus
Q6TVR6 160 LRVVRFLRRNMFTGVEVADRSVSVV 184 Orf virus
P68609 159 LKIVRFFRNNMVTGVEIADRSVISV 183 Vaccinia virus WR
Q6TUU6 159 LKVIRFFRNNMVTGVEVADRSVVSV 183 Yaba monkey tumor virus
Q85288 161 LKIVRFYKPNMLTGVELADRAVAAV 185 Molluscum contagiosum virus subtype 1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap