Conserved Protein Domain Family
VirE

?
pfam05272: VirE 
Virulence-associated protein E
This family contains several bacterial virulence-associated protein E like proteins. These proteins contain a P-loop motif.
Statistics
?
PSSM-Id: 398782
Aligned: 66 rows
Threshold Bit Score: 223.194
Threshold Setting Gi: 682098725
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
tigr:DNO_1043 120 LESL--QW--DGKPRIATAFHDFLGVERNaYTIDISTLFFRALVARVYQPAIKFDHVIVLQGD-QGISKSSFLRILGG-- 192 Dichelobacter ...
WP_009627095  183 LDKCneTH--KSTEILDTIASTYLGTTEV-IYDVMVKKTLISAVARAMRPGCKVDTTLILQGG-QGVGKSSFFKILAG-- 256 Pseudanabaena ...
WP_012597564  382 LKDCykAGqfISIDNLSQRL---LGTSNP-LYDVFVKKWLIGAVARILEPGCQMDQALILKSEkQGTGKTNFFRKLGG-- 455 Gloeothece cit...
WP_015218470  412 LDNCneESeeIDIRNLSSFV---FGTTDK-LHDEMLFRHLIGSVARVYKSGCKLDTALILQGS-QGIGKSSFFKVLYGd- 485 Cyanobacterium...
WP_013321171  181 LLKCqlN---TQVRDIKNLASEFLGCNEP-LYNEYLYRWLIGAVRRVFEPGSKFDNALVLYGN-QGVGKTSFFEILGS-- 253 Gloeothece ver...
WP_072718878  440 LETCyqKH--SDTKILDGIAQRYFGVSDE-IYQTYFKKFLIAAVARIYDPGCQQENTLILQSNhQGLFKSSFFKVLSGe- 515 Planktothrix t...
WP_006617531  404 LEDChkKW--DGQNRINGAAKRYFGTDNP-LHQRYLECLLVGTVARTKKPGCKFDTLLILHGQ-QGIGKSTWFRTMVGd- 478 Arthrospira pl...
Q8YK11        364 LQSVerRYpnVDVSLLDKLAERYFGTNDP-LHAALMKRTLIAAVARAFEPGCKHDEITILQGK-QKSLKSTFWEILAGe- 440 Nostoc sp. PCC...
WP_015127433  349 LDDVeqKFpdITGDYLDNLAYEFFGTTDP-LHTTYFKNFLVASVARARHPGCWMDCALILYGD-QGIRKSTFWRTLYGe- 425 Calothrix sp. ...
WP_095720616  330 LESVerQNpdVNENLLDNIAERYFGTSEP-LYNTYLKKTLVGLVKRIYEPGGQHDTACVLQGH-QGINKSKFWENLVPyk 407 Calothrix elsteri
tigr:DNO_1043 193 EWYSDGI-RKFEGKEAIEAIQGVLIGEIPELQGFS-KAEIEEIKAFITRTEDRARMAYGRRVQSFPRRTVFVGTTNADDY 270 Dichelobacter ...
WP_009627095  257 DFFDDGLgSNVTDQNEKMRLSAHWILEWGELERIFsQRDSSSIKAFLTSTHDSYRRPWGKNIETYPRHCVIVGSTNRDDF 336 Pseudanabaena ...
WP_012597564  456 QFFDGSFgSNLESRQSLMVLHRCWIQEWGEFERIVtKREAGEIKDFMTKLSDCFVKPYGREAVEYPRRFVFCGSTNEDDF 535 Gloeothece cit...
WP_015218470  486 NFFTD-S-VTGTDKDNLLILHQHWCAELAEFETITsKKASGELKAFLSKSVDTFREPYARSSRTIKRQSIIVGSVNECEF 563 Cyanobacterium...
WP_013321171  254 GFFSNSM-TGKLDKDDYMILAQSWVLEWGELDGFTsKTYHATIKHFLSKREDSYRVPYGKNLLKMPRRSVIVGTTNSDNF 332 Gloeothece ver...
WP_072718878  516 TYFCDDM-GDFKEKDERLKLHQNWIIEWGELERITtKKGAGTIKNFLSTREDQIRPPYARKNLKMKRQSVIVGTANPKEL 594 Planktothrix t...
WP_006617531  479 DFFCDDM-GDFKEKDERLKMHQSVWTEWAEVENNIsRSTSGKIKAFITTQTDNIRPPYAQRSTAYPRANVLVGSTNRTDF 557 Arthrospira pl...
Q8YK11        441 EFFTDDL--NGTEKDEVLKISQYWILEYAEFENSYkKKDVSQLKAFLSRKKDSMRRPYGTDIEDFPRPSILVGTTNLDEF 518 Nostoc sp. PCC...
WP_015127433  426 DCFSDDL-GNDNDKDEKMKMHRFWCLEWGEFETVYkRKDVEELKRFLAKKEETFRTPYDRVPIDYKRGFVFVGTTNQTEI 504 Calothrix sp. ...
WP_095720616  408 SWYDAEVaVGGSDKDDKLKLRAAWIIDLSEIEVVFrKNDVATLRNLLTTKHDKLRPPYGRKIETFPRMSAFVGTVNQNQF 487 Calothrix elsteri
tigr:DNO_1043 271 LRDATGNRRFFPIICh--KALDFEALAEVREQLFAEAVVHY-KAAPYvpliL---QGKEALEQAKLAQQAASY 337 Dichelobacter nodosus...
WP_009627095  337 LNDSTGSRRFWVVPVa--KKIDLRKLKENREAIWGAAVQCY-LNKEA----Wf--LNTQEEMLRQELNKEYQK 400 Pseudanabaena biceps
WP_012597564  536 LRDKTGSRRFLVIPIsnqWMIPIDLLEKERDRIWATAVREYlESKKSginaWv--LSNEEYDQLEKSNQTFRD 606 Gloeothece citriformis
WP_015218470  564 LVDATGNRRFWVIPVk--TQIDLEKVSKFRDVIWSQAKKAF-FEGEF----Wh--LSYESQKYSEELNKQYLH 627 Cyanobacterium aponinum
WP_013321171  333 LSDPSGNRRFWIIPVr-kQQIDLELLKGSVKSIWSSAVIDY-QKGISd------nLPKEFWKLQEEDNNYYEY 397 Gloeothece verrucosa
WP_072718878  595 LYDNTGSRRYWVIPVs--QSIPLNLLREERDAIWGAAVALY-KAGEN----Ww--LNSDEQQQSDTANENFQA 658 Planktothrix tepida
WP_006617531  558 NHDETGARRFMVIPVs--QVIPTNLVEDERDQLWGEVVELY-RQGRCf------yLTREEQQQANLLNKEFTE 621 Arthrospira platensis
Q8YK11        519 LYDPTGERRFWVIKVl-fKKIPIKMLQQERDLIWAAAVAAY-RNGEQ----Wr--LTEVEDEWLDAANKQYQS 583 Nostoc sp. PCC 7120
WP_015127433  505 LNDPSGDRRFWIIPVs-kAKIPVETVQVYRDKIWAAANALF-KSGYPy------mLTDEQEAQRADRNREFQV 569 Calothrix sp. PCC 7507
WP_095720616  488 LNDPEGNRRFWVIPVl--KTIPVETLILERDLIWSAAVKLY-KRGEQ----YnswLTPMEGIQQKQLNVQHTV 553 Calothrix elsteri
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap