Conserved Protein Domain Family
Tobravirus_2B

?
pfam05271: Tobravirus_2B 
Tobravirus 2B protein
This family consists of several tobravirus 2B proteins. It is known that the 2B protein is required for transmission by both Paratrichodorus pachydermus and P. anemones nematodes.
Statistics
?
PSSM-Id: 147459
View PSSM: pfam05271
Aligned: 4 rows
Threshold Bit Score: 216.635
Threshold Setting Gi: 81981713
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O91256   3 NGDWSSRWPNDHLFIDDFGKLVWFDALTDIVRISHFVSQVPTDLSPIPSSYISFIDGRIPMCVNHLGWVYIRVKfQSEEV 82  Pea early-browning virus
Q9YN75   3 NGDWADKWPVENLFVDDFGKLVWFDILDDVVRITHFVSQVPTDLSNIPKAFISFIDNRVPMCINSKGWMFIRVKvDGEDV 82  Tobacco rattle virus
P14850   1 MTNWATLWPNDRLFLSDTYQLIWFDIEADRIEHKHFKAQNSEDISMIPKGFVSFVDNRLPMCINHKGEVYIRVG-SFDTA 79  Pea early-browning virus
Q9YMD0   2 TTDRVTLWPNDQLFLSDTYQLVWFDETRDKVEHKHFSYQASNDLLSIPKSFLSFVDNRLPMCINHKGAVYIKVG-TGGDA 80  Tobacco rattle virus
O91256  83 YYQKFGEVDVSGFGESELPPDFEITFKKVTTLVDRSLM 120 Pea early-browning virus
Q9YN75  83 YYQKLGELDVSSFGDSMLPPDFEFKFTKITVPVDKQLV 120 Tobacco rattle virus
P14850  80 YYQKFGDLDVSDFDDQVLPPDRDFTFNKVVFGDVPQEQ 117 Pea early-browning virus
Q9YMD0  81 YYQKFGDLEVSKFNDDFLPQDAHFVFNNVVIGDNDDVS 118 Tobacco rattle virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap