Conserved Protein Domain Family
GP38

?
pfam05268: GP38 
Phage tail fibre adhesin Gp38
This family contains several Gp38 proteins from T-even-like phages. Gp38, together with a second phage protein, gp57, catalyzes the organisation of gp37 but is absent from the phage particle. Gp37 is responsible for receptor recognition.
Statistics
?
PSSM-Id: 147458
View PSSM: pfam05268
Aligned: 8 rows
Threshold Bit Score: 238.168
Threshold Setting Gi: 138020
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q5QC48     1 MAVVGipGWIGTSAVAETGQRWMTAASRELRLGNPSWMSQFAGRSREIIHTLGADHNFNGQWFRDRCFEAGAAPIVFNIT 80  Escherichia phage JS98
Q9G0B4     1 MAVTG--PWVGSSAVVNTGQNWMVGAAQRLRMGAPFWMSNMIGRSVEVIHTLGADHNFNGQWFRDRCFEAGSAPIVFNIT 78  Escherichia phage AR1
Q7Y4Q7     1 MAVEG--PWVGWSARVQTGDPWMGGAAQRLRMGIPFWMSNMIGRSVEVIHTLGADHNFNGQWFRDRCFEAGSAPIVFNIT 78  Enterobacteria phag...
P08234     1 MAVVGvpGWIGSSAANETGQRWMSQAAGQLRLGVPCWMSQFAGRSREIIHTLGADHNFNGQWFRDRCFEAGSAPIVFNIT 80  Enterobacteria phag...
AET36517   1 MAVVGvpGWIGSSAVNETGQRWMSQAAGQLRLGVPCWMSQFAGRSREIIHTLGADHNFNGQWFRDRCFEAGSAPIVFNIT 80  Enterobacteria phag...
P07875     1 MAIVGvpGWIGESAVNETGQRWMDAAMRAVHVSVPGWMSSMAGQSKEIYLSIGANHNYDRNSLINWMRAQGGAPVVITIT 80  Enterobacteria phag...
P07876     1 MAIVGvpGWIGESAVNETGQRWMDAAMREVRVSVPGWMSSMAGQSKEIHYSIGASNSYNKDTLINWIKAQGSTPVVITIT 80  Enterobacteria phag...
O80270     1 MAVEG--PWVGWSARVQTGDPWMGGAAQRLRMGIPFWMSNMIGRSVEIIHTLGADHNFNGQWFRDRCFEAGSTPIVFNIT 78  Enterobacteria phag...
Q5QC48    81 GDLVSYTKDVPLFFMYGDTPNEYVTLNIhGGVHMWGRGGNGg---TRVWIAGTNGGDVIQNDIGGRLRIWNYGVIASGGG 157 Escherichia phage JS98
Q9G0B4    79 GDLVSYSRDVPLFFMYGDTPNEYVQLNI-HGVTMYGRGGNGw---AACAIGASDGGVCIQNDIGGRLRINNGGAIAGGGG 154 Escherichia phage AR1
Q7Y4Q7    79 GNLVSYSKDVPLFFMYGDTPNEYVTLNIhGGVHMWGRGGNG----TVNGNPGTNGGDVIQNDIGGRLRIWNYGVIASGGG 154 Enterobacteria phag...
P08234    81 GDLVSYSKDVPLFFMYGDTPNEYVQLNI-HGVTMYGRGGNG-----GSNSPGSAGGHCIQNNIGGRLRINNGGAIAGGGG 154 Enterobacteria phag...
AET36517  81 GNLVSYSRDVPLFFMYGDTPNEYVQLNIgGGVHMWGRGGQGgwthSGGDGNGQQGGHCIQNDIGGRLRINNGGVICGGGG 160 Enterobacteria phag...
P07875    81 GDLVSNSTGNACLEFPSDLPNAYIQLIInSGVTVYGRGGNG----STNSSAGGNGGTAIHNAAGTKLRIRNNGAIAGGGG 156 Enterobacteria phag...
P07876    81 GNIVSQSTGVPCLDFPSSLTNAYVTLIInSGVTVYGRGGNG-----GSNAAGAAGGNAINNGIGTRLRITNNGAIAGGGG 155 Enterobacteria phag...
O80270    79 GDLVSYSKDVPLFFMYGDTPNEYVQLNI-HGVAMYGRGGNG-----GSNSPGSAGGHCIQNDIGGRLRINNGGAIAGGGG 152 Enterobacteria phag...
Q5QC48   158 GGAG---CASNNSWLEAGTAGGGGGRPYGLGGT--NGAVMPGGNAS----YTGPGGGG---SFGGQWGGGNGGDAGGAGG 225 Escherichia phage JS98
Q9G0B4   155 GGGG---YSQANNWAGKYVCGGGGGRPFGLGGN--NGARWPGGNAS----LTSPGAGG---NTGTRYYAGGGGEVGQPGQ 222 Escherichia phage AR1
Q7Y4Q7   155 GGGA---VSLQNSWAPNATAGGGGGRPFGIGG---GGVNWPGGNAS----YDAPGGA----GYTSQFGGGNGGDAGGRGG 220 Enterobacteria phag...
P08234   155 GGGGgywNASITRYRYRYVVGGGGGRPFGAAG------GYSGGSAStagtLTGAGIGS---KPGNAIYGGNGGNVGSAGG 225 Enterobacteria phag...
AET36517 161 GGGGi--AYRPHSGAKWQDIGGGGGRPFGPGG----GGGYSGGAAS----YDGPGGGY---NYGNAH-SGQGGDAGANGQ 226 Enterobacteria phag...
P07875   157 GGGA---ASLKNSYPTNGSCGGGGGRPFGVGGKigSDSILSGSNAS----LTDAGTG----GTTFQYGAGNGGNVGAGGG 225 Enterobacteria phag...
P07876   156 GGGG--------GNRGKLIFGGGGGRPFGAGG---SSSHMSSGATAg--tISAPGKGSvgeGSLSAYTGGAGGNVGAAGG 222 Enterobacteria phag...
O80270   153 GGGG--------GNRGRLVFGGGGGRPFGSGGS--SLSHMSAGATAg--tIYAPGAGSvgeGSLSAYTGGSGGEVGSAGG 220 Enterobacteria phag...
Q5QC48   226 GAY---GRNVKYGSQGGAGRAVFGSSPSWGATGTIYGSWL 262 Escherichia phage JS98
Q9G0B4   223 YAN---PGASYSTPPTSPGAAVAGSAPTWQNVGAIYGPRV 259 Escherichia phage AR1
Q7Y4Q7   221 DGW---GNHLSRSGGGAPGRAVFGSSPSWGATGTIYGSWI 257 Enterobacteria phage RB69
P08234   226 AFG---GISGSRYGGGAAGYAVIGSAPTWQNVGAIYGPRV 262 Enterobacteria phage M1
AET36517 227 NAWhdgGKVLKVGAGGAAGYAVIGSAPTWQNVGVIYGPRV 266 Enterobacteria phage RB33
P07875   226 RGW---GKNVYTSEGGAAGAAVTGNAPNWQNVGTIYGSRV 262 Enterobacteria phage T2
P07876   223 RCNt--QGNGTEYNGGAAGKAVTGNAPTWTKVGTIYGSRV 260 Enterobacteria phage K3
O80270   221 RCNt--HGTGTEYDGGAAGYAVIGSSPTWINVGAIYGPRV 258 Enterobacteria phage Ac3
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap