Conserved Protein Domain Family
DUF724

?
pfam05266: DUF724 
Protein of unknown function (DUF724)
This family contains several uncharacterized proteins found in Arabidopsis thaliana and other plants. This region is often found associated with Agenet domains and may contain coiled-coil.
Statistics
?
PSSM-Id: 398778
Aligned: 35 rows
Threshold Bit Score: 180.162
Threshold Setting Gi: 297326124
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CDY27128            286 VLPFANKSPLWKIYETMEVFKKLPQRPHFSPlIESTSEDFREGSALGMMATFSGLLEKLKDMEADV--TVSELDSLKDTF 363  rape
XP_015162235        335 VLPFKKNSALWREFESMEVFRKIPQNPHFSP-LAQYEENKREEVALLKMTKYVFFVERIPKLTVAElsSSVLISEMLDTI 413  potato
XP_009389242        712 lMPFSKTSSMWEPIESMEIFQVMPQQPHFHP-LEQYSMEFREGMAIGLMISFANLVANIQQIHIDD--AQATIEGRLRAL 788  wild Ma...
XP_008679659        787 QALFVKSSPVWHIVEAMHVFKELPQQPHFIP-LQEVPPTLREGMALGMMVSFADLVKVTMEASIGN--DMEWFEDKIRTI 863  Zea mays
XP_015697694        950 QPPFTKSSPIWSVVEAMDVFRKVPQRPHFLP-LKHYSLALREGIALGLTMSYPNVVNDIRKLRITD--SMETFEDSIKTL 1026 malo sina
WGS:AAAA:OsI_36466  644 QALFTKTKDTWSAFEMMEVFRKDPQEPHFLP-LQQFPEAVRENMAIGLFWSYIDAGDAISKLCITD--STKIFEKHNTTL 720  long-gr...
Q2R2Q1              608 QAPFTKRSHVWSLFEEMDVFRKMPQQPHFLP-LKHHPLGLREGTALGLMWSYTDAVDNISKLCITD--SMEIFEDHIKTL 684  Japanes...
XP_002463479        761 EIPFVKTSPLWAHIEAMEVFRKVSQRPNFHK-CQQQVPELREGMALGLMLCFANLAESVKRLCIED--DDAVFEEKMKGV 837  sorghum
BAT13691            590 ELPFVKTSPMWAQIEAMEVFSKVPQRPNFHQ-LQQHPPEFREGIALGLMYSFTNLAESINMLNVHD--DNAVFEHKMRCI 666  Japanes...
1_pfamImport          1 -PPFVRTSPLWAQIEAMEIFSKVPQRPHFHQ-LWKHVPELREGMALGLMFSFANLADSIKKLNVHD--NNAVFEDKMKGI 76  
CDY27128            364 TKLEEHGFDVTRPLSRINKLLALKGRQLKILEGRRGLDKERMDESSKRHKAELEFGeterkmvEVKRKILELQRQETALK 443  rape
XP_015162235        414 KDLEEYGFDLIPIKCHLNDLMLNNEKQTQLRSKLEEEEGKLKKCRLDKAVAKNEIN-------KIALKIKDLEKQLMSAK 486  potato
XP_009389242        789 SAFEANGFNVHCLRSRLQDLLEMHVNRRQCETRKAALKVKMLEKKDDNERLDSLIA-------AFDKAILELEQNLASFR 861  wild Ma...
XP_008679659        864 SHLEANGFSVQSIQSAMTEMVKVKTEHTSYHCEIGKLSSKLVENMASSSRAGALLD-------EKDEAAARLEEELVSIR 936  Zea mays
XP_015697694       1027 TTLEENGFNVQSLQRSLTKLLQFRSDYTNALTYREKLKAQILDKGSAVSRIGALLD-------EKDNAIFKLEQELGRLR 1099 malo sina
WGS:AAAA:OsI_36466  721 NYLVENGFNVQSLQCKLNKALQFKLDRTCSLAYREKLKEQVLEKQSSLSRIGASRD-------ENDSAMAKLEMELGRHR 793  long-gr...
Q2R2Q1              685 TILEENGFSVQSLQQILTKLLQIRSDYTNSLRDGEKLKEQIADKAFAVSRVDALLD-------ENDSAIAKLEQELGKLR 757  Japanes...
XP_002463479        838 SLLEADGFDVEHLRSRLETLLRIKKGRAKLQGTIKDMEQKFSHEETERR---TQMG-------VLNMTVRQLELQACLFR 907  sorghum
BAT13691            667 SVLEADGFDVRHLRSRLETLLSLKNSWSKIQDMMKRSEKKIAQEEIDDQQRCAEIS-------VLSMVVRQLEQHAHLFR 739  Japanes...
1_pfamImport         77 SLLEADGFDVRHLRSRLETLLSLKNSWSKIQDMMEQSDRKIAQEETDDQKLCTEVS-------MLSMVLRQFETHAHLFR 149 
CDY27128            444 ekkeaaeEQKDQACRKIWKVESCARDLGVKLEDVEFDFETIVS 486  rape
XP_015162235        487 -------TMIETMEHHIKVSGSLKGDICDDIRHAERDFEATVA 522  potato
XP_009389242        862 dkkdsviRERSSNDSEISKLQVNILEAEVTHNSAEENFKAILS 904  wild Malaysian banana
XP_008679659        937 qesqkiaKEKEKIDAEVVSIKTACSGYEDLCSGVERKFKEVLA 979  Zea mays
XP_015697694       1100 weaqkiaKNKEDEDAELLRLKAEDSNAQEACGDAKRQFHGVQA 1142 malo sina
WGS:AAAA:OsI_36466  794 wdgqmmsKKMEDEEAELSRLKAEDSNAQEACRDAEKQFRSVLV 836  long-grained rice
Q2R2Q1              758 wkgqkmsKKKEDEDAELSRLKAENNNAEEAHGDAKRQFDSIRA 800  Japanese rice
XP_002463479        908 cmmhsaiSQELSDASEISRLKAEVSKL-------EHRFSSTTA 943  sorghum
BAT13691            740 ciknraiSQQMSHAMENSRLKVEASQLKQSSMSTEQRFSSVVA 782  Japanese rice
1_pfamImport        150 cmkqhaiSQKMSHAVEKSRLRVDASELKRSSLSTEQQFSSVVG 192 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap