Conserved Protein Domain Family
Borrelia_P83

?
pfam05262: Borrelia_P83 
Borrelia P83/100 protein
This family consists of several Borrelia P83/P100 antigen proteins.
Statistics
?
PSSM-Id: 114011
View PSSM: pfam05262
Aligned: 3 rows
Threshold Bit Score: 594.288
Threshold Setting Gi: 122292643
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EMB37509  25 KPEIDSVkNKTIEFINYTGPHDVVDSADTIRGIGSNLAGAVKAGRAGDM--NRYSVIHCVDPAVKEGlDADIFIIGKNAG 102 Treponema denticola...
Q06AZ6    28 EKLKDFV-NMDLEFVNYKGPYDSTNTYEQIVGIGEFLARPLINSNSNSSyyGKYFVNRFIDDQDKKA-SVDIFSIGSKSE 105 Borreliella afzelii
O83499    23 RRELERA-NATVEFENFAGTHTDVDSAAAIRRIGEGLASALRGGVAGDR--ARYALIHAVGPHTTNGfDADILIIGAQAR 99  Treponema pallidum
EMB37509 103 VDHINNVRLIIAGYLKAAYGYSDKDAATLAHFVTIYNAVYRKNMDFFNQKYKQVVTKNLTKEKAGLALRYDEWPGQTQIV 182 Treponema denticola...
Q06AZ6   106 LDSILNLRRILTGYLMKSFDYERSSAELIAKAITIYNAVYRGDLDYYKEFYIEASLKSLTKENAGLSRVYSQWAGKTQIF 185 Borreliella afzelii
O83499   100 VDHIDNIREIVAAYLSAAYGYRLQDARTIATFTTVYNAVYRADLPTFKARYKGVVTAHLSPEHVGIARRFDQWPGKTQLV 179 Treponema pallidum
EMB37509 183 IPLTDQKYAGTI-SSVDTTSISDKKVVEKMREDKGKDLEKRKEMVDL--------------------------------- 228 Treponema denticola...
Q06AZ6   186 IPLKKNILSGNVeSDIDIDSLVTDKVVAALLSENESGVNFARDITDIqgethkadqdkidieldnihesdsnitetienl 265 Borreliella afzelii
O83499   180 IPLS--GHSDAL-SAVDTGAISDKRVVERLREDPDKNVDLRRDMIDL--------------------------------- 223 Treponema pallidum
EMB37509 229 -------------KERESEEAAKRAEvaKKEADVKQKEADKQKKEADTKQKAAEKQKKETEQKQKE-------AKKAEEK 288 Treponema denticola...
Q06AZ6   266 rdqlekatdeehkKEIESQVDAKKKQ--KEELDKKAIDLDKAQQKLDFAEDNLDIQRDTVREKLQEninetnkEKNLPKP 343 Borreliella afzelii
O83499   224 -------------KEREAQEGTRRAQqlAQQSQQAQERAAELSTQAQRAQAHADKTRREAQQAQQA-------AQNSPDP 283 Treponema pallidum
EMB37509 289 AATTGKPEDKKV-----------A------EEKKKEAEKsQKETEKKTEEAKKAKDAAdekqkkADEAKKE--VKEEEKm 349 Treponema denticola...
Q06AZ6   344 GDVSSPKVDKQLqikesledlqeQlkeasdENQKREIEK-QIEIKKNDEELLKNKDHK------AFDLKQElnSKASSKe 416 Borreliella afzelii
O83499   284 ARTQEAKEKERV-----------A-------------ERaQQEAQQAAHTAQKATEQ-------AESLARE--ARSQEQr 330 Treponema pallidum
EMB37509 350 -----aEKKTEEAQTDRKDIAS----------------------------------------DTQKIIEEKKAEKKAEGD 384 Treponema denticola...
Q06AZ6   417 kiegeeEDKELDSKKKLEPVSEadkvdkisksnnnevsklspldkpsysdidskegvdnkdvDLQKTKPQVESQPTSLNE 496 Borreliella afzelii
O83499   331 -----aQQKSAEAQRERLEVAG----------------------------------------DMQRMMNAGRAKATHGAQ 365 Treponema pallidum
EMB37509 385 A----AIASSIPGYgLKVVDDSKMLSELVLLDLKTEEELRTSGINTIRGRNLHIVGKNLMAIAGTkSGNAVIALVLiDAK 460 Treponema denticola...
Q06AZ6   497 DlidvSIDSSNPVF-LEVIDPITNLGTLQLIDLNTGVRLKESAQQGIQRYGIYEREKDLVVIKID-SGKAKLQILD-KLE 573 Borreliella afzelii
O83499   366 E----ARESVTPCYgLKVVDAQHLLSEIVLVDPKTEAPLRSSSLRTVRNRLLYSEPHALVAIADT-TGNGTVRLVHiDPK 440 Treponema pallidum
EMB37509 461 SLEIVKQSQENIAGESVLIKNGNDYYAVI---DNNGKYFIGRYNDK-LELQAKSAVEVLPYTPI 520 Treponema denticola ATCC 35404
Q06AZ6   574 NLKVISESNFEINKNSSLYVDSRMILVAVk--DDSNAWRLAKFSPKnLDEFILSENKILPFTSF 635 Borreliella afzelii
O83499   441 TLEVTKESTQRIAAQSFLLR-----ERGAllcGDRRKW------------------QPLPGTLY 481 Treponema pallidum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap