Conserved Protein Domain Family
Tra_M

?
pfam05261: Tra_M 
TraM protein, DNA-binding
The TraM protein is an essential part of the DNA transfer machinery of the conjugative resistance plasmid R1 (IncFII). On the basis of mutational analyses, it was shown that the essential transfer protein TraM has at least two functions. First, a functional TraM protein was found to be required for normal levels of transfer gene expression. Second, experimental evidence was obtained that TraM stimulates efficient site-specific single-stranded DNA cleavage at the oriT, in vivo. Furthermore, a specific interaction of the cytoplasmic TraM protein with the membrane protein TraD was demonstrated, suggesting that the TraM protein creates a physical link between the relaxosomal nucleoprotein complex and the membrane-bound DNA transfer apparatus.
Statistics
?
PSSM-Id: 398777
Aligned: 2 rows
Threshold Bit Score: 228.375
Threshold Setting Gi: 81595676
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q93GP1                  1 MAKVNVYISNEVHNKITAIVEKRRQEGARDKDISFSGTSSMLLELGLRVYEAQMERKESPFNQTEFNKVLLENVLKTQSS 80  Salmon...
wugsc:KPN_pKPN3p06001   3 MAKIQAYVSDEVAEKINAIVEKRKAEGAREKDVSFSSVSTMLVELGLRVYEAQMERKESGFNQMAFNKVLLETVLKTQFA 82  Klebsi...
Q93GP1                 81 VAKILGIGSLSPHVAGNPKFEYANMVEDIKEKVSSEMERFFHENEE 126 Salmonella enterica subsp. enterica sero...
wugsc:KPN_pKPN3p06001  83 TNKILGISCLSPHISGNQKFEWRFMIDTILEDTKEVVDTFFPESED 128 Klebsiella pneumoniae subsp. pneumoniae ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap