2OY9


Conserved Protein Domain Family
UPF0223

?
pfam05256: UPF0223 
Click on image for an interactive view with Cn3D
Uncharacterized protein family (UPF0223)
This family of proteins is functionally uncharacterized.
Statistics
?
PSSM-Id: 398774
Aligned: 53 rows
Threshold Bit Score: 111.138
Threshold Setting Gi: 405125093
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2OY9_B               4 KTTLPISLDWSTEEVIDVVHFFQAIEQAYD-QGIAREDLLGKYRRFKEIVPSKSEEKQLFRAYEQENDVSCYQTIKKARE 82  Bacillus ...
WP_012370875         2 AVNYPINPDWSTDEIVTVIQFFNTVEEAYE-KGIDRTFFLKAYQDFKTIVNSKSEEKQLDQFYFEETGCSSYRAVQQARK 80  Exiguobac...
jgi:Bcell_2657       4 dvIIPISMDWSKEEIIDVVNFYEGVDKAYK-KGIDRELMLVLYHHFKKVVRSKGEEKGYFKDYEEQTDQSPYHVMKLARE 82  Bacillus ...
WP_013172545         4 gVQLPVSMDWSTDEVIDVVNFFEAVDSAYG-KGVERDLLVTLYRHYKAVVPSKAEEKQHFKDYESQTGQSPYHTVKKARE 82  [Bacillus...
Q5WFB9               2 DMNIPIRYDWSQEEIVVVAEFFDCIALAVE-QGVTAGEIKAHYNRFKGVVTAKSEEKQLFREVDEQLGISCYKIVKRALE 80  Bacillus ...
WP_012959552         2 DMNMPISLDWSTEEVIDVVEFFQAIEKAYQ-KGIGREELLAKYRRFKEIVPSKSEEKQVFREFEQQADVSCYHTVKKARE 80  Bacillus ...
OTooleUCC:LRC_12690  7 SFSYPLMPEWSTQEIIDVSAFYEAVEKLNT-VEIKRADFMKLYGRFCEIEPSKAAQKQLDSRYEKESGFSIYRSVRFVLE 85  Lactobaci...
Q1WU74               5 NYSYPLLPDWSTEEIIIACEFYAEVEKYNT-NGVNREKFLEKYQDFLKVAPSKMFQKRLDREYEKLSGYSIYQSVKKVKE 83  Lactobaci...
tum:LSA_09860        8 NYAYPIVKDWSMQELIDVTEFFRNIERAYDeHGVNRQKLIDSFRRFQEINPARTEQNNLRRDFEKNSNLDIYQVLKNAQE 87  Lactobaci...
Q03WI5               4 NYVLPIDGDWTTQDIIIVTNFINSVLGVYE-KGSSREEVLKNYDAYRKIMPAKSEQKKFDKDFERQTGYSIYKTIKFVQN 82  Leuconost...
2OY9_B              83 EXEEHI 88  Bacillus halodurans C-125
WP_012370875        81 QTDALL 86  Exiguobacterium sibiricum
jgi:Bcell_2657      83 AKDQKV 88  Bacillus cellulosilyticus DSM 2522
WP_013172545        83 SETGTV 88  [Bacillus] selenitireducens
Q5WFB9              81 AAEHEL 86  Bacillus clausii KSM-K16
WP_012959552        81 QDENTV 86  Bacillus pseudofirmus
OTooleUCC:LRC_12690 86 NDKENL 91  Lactobacillus ruminis ATCC 27782
Q1WU74              84 NEKKFV 89  Lactobacillus salivarius UCC118
tum:LSA_09860       88 HPKTKN 93  Lactobacillus sanfranciscensis TMW 1.1304
Q03WI5              83 STKDRV 88  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap