Conserved Protein Domain Family
FlhD

?
pfam05247: FlhD 
Flagellar transcriptional activator (FlhD)
This family consists of several bacterial flagellar transcriptional activator (FlhD) proteins. FlhD combines with FlhC to form a regulatory complex in E. coli, this complex has been shown to be a global regulator involved in many cellular processes as well as a flagellar transcriptional activator.
Statistics
?
PSSM-Id: 398768
Aligned: 35 rows
Threshold Bit Score: 109.989
Threshold Setting Gi: 357939041
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011795131      3 SEQLLAEIREANLTYLMLAQTLIRQDKAEAVFRLGINEDAADILASLSAAQVLKLASRNTLLCSFRVDDNLVWSLLTNHn 82  Acidovorax c...
Q1GZX7            3 EQEIMAEIKDANLSYLMLAQQMIRADKASAIFRLGLSQEIADLLEGLSNAQLLKLSSFNMMLTRFRFDDTAILGMLTSY- 81  Methylobacil...
WP_013441636      3 EKDMMSDIKDANLSYLMLAQQMIRSDKASAIFRLGVSKEIADVLESLTTAQLLKLSSTNMMLARFRFDDCAILNMLTSY- 81  Methylovorus
WP_025420841      3 TSEVLKNIYGINLSYLSLAQRLIQTDKSSAMFRLGISESMAETLQKLTMAQMVKLAETNQLLCVFRFEDPKAITQLTQD- 81  Sodalis prae...
Q6D6J5            6 TSELLKHIYDINLSYLLLAQRLINDEKASAMFRLGINDEMANILMQLTLPQMVKLAETNQLICHFRFNDHNTIKVLTQE- 84  Pectobacteri...
P59992            3 TVELLKHIYDINLSYLLLAQRLINHEKASAMFRLGISDSMADTLSELTLPQLVKLAETNQLVCNFRFEESETIQQLTRE- 81  Photorhabdus...
wugsc:CKO_01056   6 TSELLKHIYDINLSYLLLAQRLIVQDKASAMFRLGISEEMANTLGTLTLPQMVKLAETNQLVCHFRFDNHQTVTQLTQD- 84  Citrobacter ...
Q8D3H1            3 NDNILKNIHEINLSYLLLAQELIKQDKKVASFRLGVCEDTLNKISKLSLSELIKLGAINQLICLLRLDDEKVINCLTRE- 81  Wigglesworth...
WP_014995731      3 VDNVLNEIQDLNLTYLLLAQRLLQEDFATALFRLKIDESMAEVLLSLSARQLSRLARTNQFLFRLGLDDAGQLQALTNH- 81  Alcanivorax ...
Q1QVX9            3 TDSLLDDIQDINLSYLLLAQRMISEDRTTALFRLKIDDEMADLIASLSIKQLTQLSRTNQLLCRLCYDEPEQLRKLTHN- 81  Chromohaloba...
WP_011795131     83 tpkkVGNETTNTLHANILMASRVSE 107 Acidovorax citrulli
Q1GZX7           82 ----TKDRMQAQAHAAILMAGQGVE 102 Methylobacillus flagellatus KT
WP_013441636     82 ----TKDRHLASAHAAILMAGQAPE 102 Methylovorus
WP_025420841     82 ----SRVEDLNQIHASILLSSRLNE 102 Sodalis praecaptivus
Q6D6J5           85 ----SRVDDLQQIHTGILLSSSLLQ 105 Pectobacterium atrosepticum SCRI1043
P59992           82 ----SRVDDLQQIHTGILLSTHLFQ 102 Photorhabdus laumondii subsp. laumondii TTO1
wugsc:CKO_01056  85 ----SRVDDLQQIHTGIMLSTRLLH 105 Citrobacter koseri ATCC BAA-895
Q8D3H1           82 ----SRVDELQQVHTGIMLSTQLLR 102 Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis
WP_014995731     82 ----KREQGLGQTHAALLMTAtgda 102 Alcanivorax dieselolei
Q1QVX9           82 ----QREQGLGQTHAALLMASARSE 102 Chromohalobacter salexigens DSM 3043
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap