Conserved Protein Domain Family
Brucella_OMP2

?
pfam05244: Brucella_OMP2 
Brucella outer membrane protein 2
This family consists of several outer membrane proteins (2a and 2b) from brucella bacteria. Brucellae are Gram-negative, facultative intracellular bacteria that can infect many species of animals and man.
Statistics
?
PSSM-Id: 113995
View PSSM: pfam05244
Aligned: 2 rows
Threshold Bit Score: 331.787
Threshold Setting Gi: 75346701
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q45323  79 MRSLQIEGCLFGGNELCTTPDSPIAAPLTVVLVRRRCGRICALQPNRELVGDVDVATNLGSPFFDDRVIGNNTSDRTPAA 158 Brucella neotomae
Q45329  79 MRSLQVEGSLLRSLILQTTPDSPIAAPLTVVLVRRRCGRICALQPYREPVGDVDVATNLCSPFFDDRVIGNNTSDRTPAA 158 Brucella ovis
Q45323 159 SILQAANNVRHVAVDVVvgrasVTTVVVATLFESDHSREAVSASEGVRDLAGAVGASRDHVIVDDIAEVTGEGMEFRFID 238 Brucella neotomae
Q45329 159 SIFQAANNVRHVTVDRV-----IVVNVFATLFESDHSREAVSAGEGVGDLAGAVGASRDHVIVDDITEVTGEGMEFGFVD 233 Brucella ovis
Q45323 239 TNAQTTELDIRELHDGAAAgfitiftiYARIvrsivEaqfgeglegaefgfrtggnaecetsalvpAIAVGTGVNVIAAL 318 Brucella neotomae
Q45329 234 TNLETTKRDICKLQIGAGA--------YAAI-----S-----------------------------DITIIAEIAVLAIM 271 Brucella ovis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap