6QLF


Conserved Protein Domain Family
CENP-N

?
pfam05238: CENP-N 
Kinetochore protein CHL4 like
CHL4 is a protein involved in chromosome segregation. It is a component of the central kinetochore which mediates the attachment of the centromere to the mitotic spindle. CENP-N is one of the components that assembles onto the CENP-A-nucleosome-associated (NAC) centromere. The centromere, which is the basic element of chromosome inheritance, is epigenetically determined in mammals. CENP-A, the centromere-specific histone H3 variant, assembles an array of nucleosomes and it is this that seems to be the prime candidate for specifying centromere identity. CENP-A nucleosomes directly recruit a proximal CENP-A nucleosome associated complex (NAC) comprised of CENP-M, CENP-N and CENP-T, CENP-U(50), CENP-C and CENP-H. Assembly of the CENP-A NAC at centromeres is dependent on CENP-M, CENP-N and CENP-T. Additionally, there are seven other subunits which make up the CENP-A-nucleosome distal (CAD) centromere, CENP-K, CENP-L, CENP-O, CENP-P, CENP-Q, CENP-R and CENP-S, also assembling on the CENP-A NAC.
Statistics
?
PSSM-Id: 398764
Aligned: 28 rows
Threshold Bit Score: 215.766
Threshold Setting Gi: 306756344
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6QLF_N  15 SDTLVVFKQLMKLPVTVLYDLTLSWFAKF--------------------------------GGSFDGDIYLLTETLDLLI 62 
P0CH66  22 PHSISLRRLLSRLDKSELVSLVTRWLDNAgpsyippmlsrrq-------pkagqedsvtnlTLYHAILDLNEERRCRSMD 94  Ustilago maydis 521
Q801T9   4 QARSVLNRVIRRIPNKNIKNLLSKW-------------------------------------------NCLSADQLQALD 40  zebrafish
Q5XGF1   4 WIAEFIKRIILKLPFSQTMTILKAW-------------------------------------------GFLTDSELQTLT 40  tropical clawed frog
Q32LL9   4 TLAEFFRRTILKIPMTEMMTILKTW-------------------------------------------NFMSENQLQTVN 40  cattle
Q9CZW2   4 NVAEFLRRTILKIPLSEMKSILEAW-------------------------------------------DFLSEDQLQTIN 40  house mouse
Q7TME4 131 NVAEFLRRIILKIPLCEMKTILEAW-------------------------------------------DFLSEDQLQSIN 167 Norway rat
Q9C0W0  12 KHDKKIQKLLNRFPRDFLVKLCVEWIQKqtyppn---------------------akdinlEDMLDDEEWNPEAFYKNVP 70  Schizosaccharomyces p...
Q6CHY4  27 QTTNLRRNALNKCSHNTLYNLTQLWLGSKdclplvainsqddylfdldalsddeddaeadeGIDEVEEGVIVARGGPKYE 106 Yarrowia lipolytica
Q751F7  11 sgtSEAALKLNKLEGPEVKKLVRSWLV-----------------------------------------KFPPANGTIELG 49  Eremothecium gossypii
6QLF_N  63 E---------K--GVRRNVIVNRILYVYWPDGLNVFQLAEIDCHL-MISKPEKFKWLPSKALRGDG----KPYVVKLQPA 126
P0CH66  95 ElrllwtgpmSdpRVPKARALDRISDVDWPEGLSYAMVAELDLFY-AHARQLSKTWSTVKLEYDDDvdaaGRGWERLSET 173 Ustilago maydis 521
Q801T9  41 Y------------TKPKRMIVEHIIDCCESSSLNLKHITNLEMIY-HLDNPDQGTWYACQLTDAQD------DAVCVELT 101 zebrafish
Q5XGF1  41 L------------RYPKDITATEVVRLCEAKNATIDHAAALDFVF-NHAFSNKKLWTVYQMSKTSE-----SENDLFDAS 102 tropical clawed frog
Q32LL9  41 F------------RQRKESIVQDLVLLCEENHASLNDAAHLDIIY-TQFHRHQKIWDVFQMSKAPG-----DDIDLFDME 102 cattle
Q9CZW2  41 L------------KQRKDYLAQEVILLCEDKRASLDDVVLLDIVY-TQFHRHQKLWNVFQMSKEPG-----EDVDLFDME 102 house mouse
Q7TME4 168 L------------KQRKEFLAQEVILLC-----------EVTCNR-AFDKSS--DFLLPQACSEAG------------YR 209 Norway rat
Q9C0W0  71 Ksm------------lKRSIIHRMLVYDWPNGFYLGQIAQLEILA-LAHGFVSMRWTASKVHHSAE----KTVLP--NPL 131 Schizosaccharomyces p...
Q6CHY4 107 KimddarkelTegVQSRKAYMQLVGQKYWNAGLNLLQLAQLDIWGdVFERPEMLVWSYSTVKDSVG----KEKVPDLSIG 182 Yarrowia lipolytica
Q751F7  50 Ni-----------DCDAKKLIDIATGHLWPGGLNCYQIAQLDVAC-LVADKTQMSWAVSAVHDKDG----KEAVLALDFK 113 Eremothecium gossypii
6QLF_N 127 KFIENLQTDLAKIYHCHVYM---FKHPSLPVLITRIQLFDSNNLFLSTPNIgsinkeslynkldkfqgKPLISRRPYYVA 203
P0CH66 174 QIRLRLGNELGHYFEHHIYLhprVKPEDRNAAAVRSWTDSFSYFRIVLAPI-----------------PSDVCGTGLHIL 236 Ustilago maydis 521
Q801T9 102 QFKEQFKAHLHGVIRHISIK---MKKHEDDAIWIRI-AWGDNFSKPNH-------------------------LKPTYVV 152 zebrafish
Q5XGF1 103 EFKLQFKKSIHAVSKNVTIN---FKEFGEAL-WIRI-AWGTHNTRPNQ-------------------------YKATFAV 152 tropical clawed frog
Q32LL9 103 QFKSSFKKILQRALKNVTVS---FRDAEENSVWIRI-AWGTQYKKPNQ-------------------------YKPAYVV 153 cattle
Q9CZW2 103 QFQSSFKRILQRALKNVTVS---FRVYEKDSVWIRV-AWGTQYSQPNQ-------------------------YKPTFVV 153 house mouse
Q7TME4 210 VFPTQTQNQVTVS----------FRVYEKNSVWIRV-AWGTQYSQPNQ-------------------------YKPTFVV 253 Norway rat
Q9C0W0 132 VFLELLKSELESIFVYHTYI---SRHETLPITFIRLVLWDSKRPTALH--------------------TYPSSKQIFYLG 188 Schizosaccharomyces p...
Q6CHY4 183 TIATRMSEAIYPAFRCHVHA---MRHPELPVIVVRVKPYDAANDDARL--------------------------KPLYLV 233 Yarrowia lipolytica
Q751F7 114 RFGADLRTQVGHVHMCHVYS---EMHAKLPLVLYRVQLFDSYGSQMVT-------------------------HKAFFAV 165 Eremothecium gossypii
6QLF_N 204 FPLNSPIIF------------------------------HSVDKD--IYARLVLQ---------SISRTISE---RETII 239
P0CH66 237 HLPRTPFLLvsgslgrgsenremalsafaaaagattvnyAKPAAGsaAAKKLLAElndagedaaGNRRTLGElrgKDPLA 316 Ustilago maydis 521
Q801T9 153 HHLHTSYVFis---------------------------nLMAKHKifLCQALVVA--------------------TRHGS 185 zebrafish
Q5XGF1 153 YHSQTPHVFit---------------------------gLGKACRplLCQALVIA--------------------SKYSQ 185 tropical clawed frog
Q32LL9 154 YYSQTPYAFts--------------------------ssRLKSNLplLGQALTVA--------------------SKHHQ 187 cattle
Q9CZW2 154 YYPQTPYAFis--------------------------scHLKNTVplLHQALKVA--------------------SKHHQ 187 house mouse
Q7TME4 254 YYPQTPYVFis--------------------------scYLKSTVplLHQALKVA--------------------SKHHQ 287 Norway rat
Q9C0W0 189 LMDDSDVLL------------------------------HNIFLRndVCHSLFLQ---------CLSRLLYRl--KAGSA 227 Schizosaccharomyces p...
Q6CHY4 234 FPYHSPHVI------------------------------HLSMDH--VYAQTVLH---------AVTQSVTTv--ADPIS 270 Yarrowia lipolytica
Q751F7 166 LPLRYKVVL------------------------------HSAQKD--VHSRYIFQ---------CVTQALQAs--RPGVQ 202 Eremothecium gossypii
6QLF_N 240 FK----PvQKIPVKS-IHNIMTLLGPSRFAESMGPWECYA-SANFERSPLHDYKKHQGLTGKKvmvrefddsflnddenF 313
P0CH66 317 LReillH-ESGRLSStSDASAAPAG-----VAGGGKARQM-QFSQGGSGQGAEDGPLIAPLKR----------------R 373 Ustilago maydis 521
Q801T9 186 IK----D-GHLSTRS-LTAMRDLL-LRRYQQVFPSAQSKI-QQERDSPPLHPCIG------------------------- 232 zebrafish
Q5XGF1 186 IQ----E-MELKSRC-LESLKDIV-FKRFN------QPFS---SHHSRPHEKALTQKIV--------------------- 228 tropical clawed frog
Q32LL9 188 IV----K-MDLRSRY-LDSLKAIV-FKQYNQSFETHNCTT---SLQEGSLGLDINM------------------------ 233 cattle
Q9CZW2 188 IV----H-LDLRSRH-LDSLKAIV-FREYNQTCENYSSTT---SLQEASLSMCL-------------------------- 231 house mouse
Q7TME4 288 MA----Q-LDLRSRH-LDSLTAIV-FNEYDQTFENYNSTA---SWREGSLGLKTDCMCALRQG----------------G 341 Norway rat
Q9C0W0 228 LR----P-IDLVSKN-LTTFCTNVGVNKEANALGAWQIYA-KNLVDRSPLDTRPILSD---------------------- 278 Schizosaccharomyces p...
Q6CHY4 271 LVr---S-SALPTRS-FNTLVTTLSDNRKAASMGSWSVFA-TGEVDQSPLAMVKKPPAKVANS----------------K 328 Yarrowia lipolytica
Q751F7 203 LQ----L-MAGPVKDiLTNVDRAYGTSILPDVQGVWSSYLyD-DIEPSPLHSPTKHPVVVGKR----------------K 260 Eremothecium gossypii
6QLF_N 314 ----------------YGkeepeirrlrlek----nmikfkgsangvMDQKYNDLKE---FNEHVHnirngkknE----- 365
P0CH66 374 reed--------lsllGIrpptppasgserdtvslssastsarptqrRSSLTPCSQTpqeTHQHAR--------Ealttr 437 Ustilago maydis 521
Q801T9 233 -----------------------------------------------KEHSDYEEMR----------------------- 242 zebrafish
Q5XGF1 229 -----------------------------------------------DPRVTYENMR---EKERVH--------H----- 245 tropical clawed frog
Q32LL9 234 -----------------------------------------------DSRIIHENKV---EKERVQ--------R----- 250 cattle
Q9CZW2 232 -----------------------------------------------DSKITHENTE---EKVRVH--------R----- 248 house mouse
Q7TME4 342 lgagvfafswqlrskvQTviesafmpnsmppflhvinscpvkkryavDSKIIHENTE---EKVRIH--------R----- 405 Norway rat
Q9C0W0 279 -----------------------------------------------DNSSLIADST---QNCEKH--------R----- 295 Schizosaccharomyces p...
Q6CHY4 329 -----------------------------------------------ANRIAAKFTSkkiTEPLQY--------R----- 348 Yarrowia lipolytica
Q751F7 261 redddklrdiqrc----------------------ammrfkgttsgvKSLVRYLDKR---HRQRVY--------Svsdgq 307 Eremothecium gossypii
6QLF_N 366 ---DSGEPVYISRY--------SSLVPIEKVGFTLKNEI---------------------NSRIiTIKLKFNGNDIFGGL 413
P0CH66 438 mesQREANELFGPKpnpydpsnDALPRVERIEYELHLPFpamqryntrs-lidmdaynsdPEKP-KIKLRLEGTHVLAGL 515 Ustilago maydis 521
Q801T9 243 ---HQMACEAFGHG---------PTPKLETAVYKLETRYrgngn-----------ltvsdREEFfRGVVRFSSSSLLESL 299 zebrafish
Q5XGF1 246 -----LTRETFGEG---------PLPKLELASYKLETMFraesim---------ggnltaGNEPfRCVVKFSSPHLLEAI 302 tropical clawed frog
Q32LL9 251 -----VTQEIFGDY---------PQPRLEFAQYKLETKFksdlng----------gilaeREEPlRCLVKFSSPHLLEAL 306 cattle
Q9CZW2 249 -----VTQETFGTY---------PQPQLEFAQYKLETKFksnigg----------glladRKEPfRCLVKFSSPHLLEAL 304 house mouse
Q7TME4 406 -----ATQEAFGAY---------PQPQLEFAQYKLETKFksdvgg----------giladRKEPlRCLVKFSSPHLLEAL 461 Norway rat
Q9C0W0 296 ---EMAIQRRFGDT---------HSQVLDKLLITLDHDYiekstekdkvleenvesynptEQRP-LVVMQLRGQHILEGL 362 Schizosaccharomyces p...
Q6CHY4 349 -----------------------SENPQSMVEFRI-------------------------TRNSrKVTLRMEGTDVYAGV 380 Yarrowia lipolytica
Q751F7 308 vddPSTDEEEINKY--------QSLVPVRKVEYTVKNTT------------------------SlGFKLKLRGKDVFAGL 355 Eremothecium gossypii
6QLF_N 414 HELCDKNLINIDKVPGWLA-GENGSFSGTIMNG 445
P0CH66 516 RKLVAAGM--DRSTSRLDA-GEGQGDDDDEEDG 545 Ustilago maydis 521
Q801T9 300 RNCVASGMAEGPVTPLLSAiTRRGRNSFVITDK 332 zebrafish
Q5XGF1 303 RSLAPAGIAEAPISTLLSCiPHKARNSFKITEK 335 tropical clawed frog
Q32LL9 307 KSLAPAGIADAPLSPLLTCiPNKGKNYFKIRDK 339 cattle
Q9CZW2 305 KSLAPAGIADAPLSPLLTCiPSKKMNYFKIRDK 337 house mouse
Q7TME4 462 KSLAPAGIADTPLSPLLTCiPSKKMNYFKIRDK 494 Norway rat
Q9C0W0 363 KDICRQDALDPFTMPSYLT-GETGLSILYVRDG 394 Schizosaccharomyces pombe 972h-
Q6CHY4 381 YRMAMRGDINDRKMPAWMT-GEESSTSGAVNDG 412 Yarrowia lipolytica
Q751F7 356 HELCDKQILDINRLPGWLT-GENGADSGIVEDG 387 Eremothecium gossypii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap