Conserved Protein Domain Family

pfam05234: UAF_Rrn10 
UAF complex subunit Rrn10
The protein Rrn10 has been identified as a component of the Upstream Activating Factor (UAF), an RNA polymerase I (pol I) specific transcription stimulatory factor
PSSM-Id: 113985
View PSSM: pfam05234
Aligned: 2 rows
Threshold Bit Score: 149.58
Threshold Setting Gi: 1723521
Created: 11-May-2020
Updated: 7-Aug-2020
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
P38204   1 MDrN--VYEACSNIIKEFGTHVVSADEVLAekiDNAVPIPfktrEEIdadveKDrnegvfegniiPDIdLRVVHYYATQL 78  Saccharomyces cerevis...
Q10360   1 MS-NppTRPTLYNLVNADGELSYRARDLVQ---DFSVPIP----HEL-----PD-----------PDL-VHSIQDFATEY 55  Schizosaccharomyces p...
Q10360  56 MLATGKKSFECLDESALLGLGYLVTEWMDAMVTDCLEEFEER 97  Schizosaccharomyces pombe 972h-
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap