Conserved Protein Domain Family
PHB_acc

?
pfam05233: PHB_acc 
PHB accumulation regulatory domain
The proteins this domain is found in are typically involved in regulating polymer accumulation in bacteria, particularly poly-beta-hydroxybutyrate (PHB). The N-terminal region is likely to be the DNA-binding domain (pfam07879) while this domain probably binds PHB (personal obs:C Yeats).
Statistics
?
PSSM-Id: 398761
Aligned: 91 rows
Threshold Bit Score: 39.7948
Threshold Setting Gi: 307632034
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Mrad2831_5117  77 LPVAFLRQLIRFYGDSMRTMVPSFLEFSMANFAKDQDGLR 116 Methylobacterium radiotolerans JCM 2831
jgi:Bresu_3229     86 LPVQFLRQLIGFYGGQMEGVLPSYLEMSLENFSRQQEQFR 125 Brevundimonas subvibrioides ATCC 15264
jgi:Astex_0840    100 LPIQFLRQLISFYGDSMQNLLPTYLEMSLDGFAKQQERFR 139 Asticcacaulis excentricus CB 48
jgi:Caul_4516      92 LPIQFLRQLIGFYGNSMQAFLPSYLEMSLESFTKQQERMR 131 Caulobacter sp. K31
Q0AM16             76 LPVDFLRQLIGFYGDSLQSVVPGYLQMSMNSFSQQQEEFR 115 Maricaulis maris MCS10
Q0BWR7             76 LPLNFLRQLIGFYGGGAQAYLPSFLEMSMNSFSQAQKEWR 115 Hyphomonas neptunium ATCC 15444
jgi:Plav_1572      78 LPINFLRQLIRFYGDSLQSFIPSYLEMSMNSFSKEQEKLR 117 Parvibaculum lavamentivorans DS-1
WP_015828189       79 LPISFLRQVIQLYGESIQSVLPSYLELSMNTFLSQQEKWR 118 Hirschia baltica
CBS87597           77 LPISFLRQLIGFYGDNMQSVVPRYLEYSMQAFSRNQEQMR 116 Azospirillum lipoferum 4B
QianUST:TMO_0156   82 LPTSFLRQLISFYGDSLQAFVPRYLEMSMESLARNQEQVR 121 Tistrella mobilis KA081020-065
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap