Conserved Protein Domain Family
BTP

?
pfam05232: BTP 
Chlorhexidine efflux transporter
This family represents a conserved pair of two transmembrane alpha-helices. All members carry the two pairs of TMs. BTP is a form of drug efflux pump, that actively tranports chlorhexidine out of the cell. Chlorhexidine, a bisbiguanide antimicrobial agent, is commonly used as an antiseptic and disinfectant in hospitals, and there is an increasing problem with resistance to it in some pathogenic bacteria. BTP is localized in the cytoplasmic membrane.
Statistics
?
PSSM-Id: 398760
Aligned: 195 rows
Threshold Bit Score: 30.5326
Threshold Setting Gi: 529145968
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Fbal_3166  70 SWGLRVGHGVGFEAGLVTVTIPVLMFSLNLGFVDALIMDIGFVVFFLVYAIIYNWAYDQFRAR 132 Ferrimonas balearica DSM 9799
Q0BV69          9 SSWDRIRHAILFEVIGLLLLIPIGHAVLGVDTGTFGSLSVIVAVTAAIWAYLFNLGFDQVMLR 71  Granulibacter bethesdensis CGDNIH1
Q6AR48          5 SQFDRIRHTVLFEVFGVIFSAPLAAFILTSNFKTTGIFAVSVSMLAMFWNWLYNMGFDHLLVR 67  Desulfotalea psychrophila
Q316J7          3 TRMDRIRHTLLFEAVLMVLLILILPPLLGVSVQKIGGLSVIMSMLAMGSNFAYNVMFDKILla 65  Desulfovibrio alaskensis G20
Q72FA6          3 TRADRIRHTLLFEILLITTTVLVLPGVLGVPAHSFGMLSVIMSTLAMLWNYLYNVAFDRMLLR 65  Desulfovibrio vulgaris str. Hil...
Q5NEE3          7 SFLARLIHTIGFEFFGIIIFTPFVMFILHQDVFHIASLAIIISLIAMLWNFIYNYIFDIIEik 69  Francisella tularensis subsp. t...
WP_014322966    3 THADRLRHTLLYEFFGLLTCTPLAAWALDRELLRVGMLSVSMSAAAMICNYLFNLAFDHLLLR 65  Desulfovibrio desulfuricans
WP_015850467    3 TTADRIRHTLLFEIIGLCTCTPLASWILDKDMSRIGIMSIAISMTAMVCNYLYNLLFDKALva 65  Desulfovibrio salexigens
WP_011867589    5 TRFDRIRYLVGFELGAMVLAVPLGAWLTSVDSRALLALAIGMSLIAAAWNYGYNLLFDRAMLy 67  Shewanella loihica
WP_012329577    3 STRDRIRHAILFEVIGLLLIVPLGTAAFGLHAADMGVIGVGSALVATSWNYVYNLGFDRAMQR 65  Methylobacterium
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap