Conserved Protein Domain Family
DUF707

?
pfam05212: DUF707 
Protein of unknown function (DUF707)
This family consists of several uncharacterized proteins from Arabidopsis thaliana.
Statistics
?
PSSM-Id: 398748
Aligned: 42 rows
Threshold Bit Score: 390.396
Threshold Setting Gi: 226516674
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_009404256  70 QCKPSGSEPLPEGIIRRTSNLEMRPICGLSQSSKtketKRASRSLLAMAVGIKQKEVVNQIVEKFSSSkFTVMLFHYDGV 149 wild Malaysian ...
XP_010320937  89 PSNPKGAERLPPGLVASESDYYLRRLWGNPSEDLs----SKPKCLVTFTVGVKQKHNIDVAVKKFSDD-FTILLFHYDGK 163 tomato
XP_014634413  82 STNPRGAERLPPGIVNAESDLFLRRLWGLPSEDL----TFKPKYLVTFTVGYEQKKNIDAAVKKFSKD-FTILLFHYDGR 156 soybean
VDC68577     127 PSNPRGAEMLPPSFVEAESDLYLRRLWGLPKDDLp---EVKPKYLVAFTVAYEQRKNIDACIKKFSDN-FTVVLFHYDGR 202 field mustard
Q8VYF6       102 PSNPRGAEMLTPGIIAPESDYYLRRLWGLPEEDV----PVKPKYLIAFTVGFGQKVNVDACVKKFSKD-FTIVLFHYDGR 176 thale cress
XP_009113820  81 PSNPKGAERLPPGIIASESDLYLRRLWGNPEEDL----KKKPRYLVTFTVGYKQRQNIDACVKKFSDN-FTIVLFHYDGR 155 field mustard
ERN19847     144 TKNPRGAELLAPGIVVSESDLELRRLYGDPSEDI-----VKSKYLLVLTVGMRQMDIVNDIVSKFSEN-FSVLMFHYDGT 217 Amborella trich...
XP_002966121  31 fTQAAGTETLPPTIVEGQTDLFLRRLWGNPEEDL----PFKPRYLLTLTVGSNQMEMVDKAVSKFDKD-WMIVLFHYDAH 105 Selaginella moe...
EFJ06933      64 NIKPSGTETLPPGIIVPQTDLLLRRLWGDPNEDI----VHRPKYLLAVTVGFDQREMVNKAVSKFDKD-WFVVLFHYDGR 138 Selaginella moe...
XP_006357566  82 PTNPRGAESLPPRIVVPESDFYLRRLWGEPSKDL----IKKPKYLVTFTVGLNQKDNIDAAAKKFSED-FQILLFHYDGR 156 potato
XP_009404256 150 VDEW-RDLRWSDSTIHVSAINQTKWWFAKRFLHPDIVAEYDYIFLWDEDLGVEHFHPQRYISIIDKEGLEVSQPALDTS- 227 wild Malaysian ...
XP_010320937 164 TTEW-DEFEWSKRAIHVSARKQTKWWYAKRFLHPDIVAPYDYIFIWDEDLGVEHFDANEYIKLVKKHGLEISQPGLDPI- 241 tomato
XP_014634413 157 TTEW-DEFEWSKQAIHVSVHKQTKWWYAKRFLHPDIVAPYDYIFMWDEDLGVENFNAEEYLKLVRKHGLEISQPALEPSk 235 soybean
VDC68577     203 TSEY-DEFEWSKRAIHVSVPKQTKWWYAKRFLHPDIIAPYEYIFLWDEDLGVENFDAEEYIKIVKKHGLEISQPAVESRk 281 field mustard
Q8VYF6       177 TTEW-EELEWSKRAIHVSVPKQTKWWYAKRFLHPDIVAPYDYVFIWDEDLGLENFDVEEYIRLIKKHGLEISQPAVESKk 255 thale cress
XP_009113820 156 TSEWdDEFEWSKNVIHISVRKQTKWWYAKRFLHPDIVARYDYIFMWDEDLGVDHFDAEEYIHMVKKHGLEISQPGLDPEk 235 field mustard
ERN19847     218 ASEW-DQFEWSQRAIHVSGRKQAKWWYAKRFLHPDIVAPFEYIFIWDEDLGVENFNAEEYLKLVRKHNLEISQPGLAENd 296 Amborella trich...
XP_002966121 106 TDAW-DQFEWSQRAVHVSVRKQTKWWYAKRFLHPDVIEPFEYLFLWDEDLDLEHFDAHKYIELVRKHGLDISQPGLEPDr 184 Selaginella moe...
EFJ06933     139 TDGW-DQYEWSQRAVHVSVRKQTKWWYAKRFLHPDVVALFDFIFIWDEDLDLEHFDAQEYVDLVRRYQLEISQPAVDGV- 216 Selaginella moe...
XP_006357566 157 TSEW-DEFEWSKRAVHISVRKQTKWWYAKRFLHPDVVAAYDYIFIWDEDLGVENFNAEKYIRLVKRHGLEISQPGLEPNs 235 potato
XP_009404256 228 KSE-VHHQITARGRKGDVHrRVYKvKSSGGCYENSTAPPCTGWVEMMAPVFSRTSWHCVWNMIQNDLIHAWGLDMKLGYC 306 wild Malaysian ...
XP_010320937 242 K-G-TTWPMTIRRGNGEVH--TLAeEKPGKCQD-PHLPPCAAFVEIMAPVFSRDAWRCVWHMIQNDLIHGWGLDFALHKC 316 tomato
XP_014634413 236 STKaVCWNMTRRREHSEVH-KEAV-E-PGKCKY-PLLPPCAAFVEIMAPVFSRNAWRCVWHMIQNEFVHGWGLDFAFRKC 311 soybean
VDC68577     282 K---ITWRITKRIPGIEVH-KEVEgGAPGQCKD-PHLPPCAGFIEIMAPVFSRDSWRCVWHMLQNDLVHGWGLDFALRKC 356 field mustard
Q8VYF6       256 K---ITWEITKRKTKGEVH-KDAK-EKPGRCND-PHLPPCAAFIEIMAPVFSRDAWRCVWHMIQNDLVHGWGLDFALRKC 329 thale cress
XP_009113820 236 G---CTWQITKKREHVEVH-KETD-EKLEWCSN-PPRPPCAAFVEIMAPVFSRDAWRCVWHMIQNDLVHGWGLDFALRRC 309 field mustard
ERN19847     297 A---LTWFMTRRRVDVEVH-METE-ERPGWCHD-RHLPPCAGFVEIMAPVFSRRSWRCVWHMIQNDLIHGWGLDLALQKC 370 Amborella trich...
XP_002966121 185 G---LTWQMTKRRGDVEVH-KTTE-EKPGWCSAGPHKPPCAAFVEIMAPVFSRKAWRCVWHMIQNDLVHGWGLDFGLQKC 259 Selaginella moe...
EFJ06933     217 ----LTWQMTKRRGDVEVH-KDAE-ERPGWCADGPEKPPCAAFVEIMAPVFSRNAWRCVWHMIQNDLVHGWGLDFNLQKC 290 Selaginella moe...
XP_006357566 236 G---LTWQMTKRRDDREVH-KNTD-EKPGWCSN-PRLPPCAAFVEIMAPVFsreawrcvwhmiqNDLVHGWGLDFALRRC 309 potato
XP_009404256 307 VqGDRSKNIGVVDSEYIVHMGIPTLGGSdenkpnaetssppseseqpylGTmvpSGSSSYndrSAIRRQSYAELMIFQRR 386 wild Malaysian ...
XP_010320937 317 V-EPAHEKIGVVDAQWILHQSVPSLGNE----------------------GqakDGKAAW---RGVRERCEKEWSMFQSR 370 tomato
XP_014634413 312 V-EPAHEKIGVVDTQWIVHQGIPSLGNQ---------------------GEtqtTGKPAW---RAVKERCGMEWRMFQGR 366 soybean
VDC68577     357 V-EPAHEKIGVVDSQWIIHQKIPSLAAQ---------------------GTs-qDGKSAF---QGVRERCHMEWTIFEKR 410 field mustard
Q8VYF6       330 V-EPAHEKIGVVDSQWIIHQSLPSLGSQ---------------------GEa-qDGKAGW---QGVRDRCKREWTMFQSR 383 thale cress
XP_009113820 310 VaEPAYEKIGIVDTQWIVHQFIPSLGSQ---------------------GKe-eDGKSPW---QGVKDRCHMEWKMFERR 364 field mustard
ERN19847     371 V-EPAHEKIGVVDAQWIVHKVLPSLGDQ---------------------GDa-kDGRQPW---EGVRARCNDEWAEFRIR 424 Amborella trich...
XP_002966121 260 A-TPAHERIGVVDAQWIRHKGVPSLGS-----------------------QatvEGRPPW---EGVRERCNKEWRMFSER 312 Selaginella moe...
EFJ06933     291 A-QPAHEKIGVVDSQWIQHKGVPSLGSQ---------------------GQtvqGGKPPW---QGVRERCRLEWRIFTER 345 Selaginella moe...
XP_006357566 310 V-EPAHEKIGVVDSQWIVHQFVPSLGSQ---------------------GEt-eNGKAPW---EGVRERCTNEWAMFQDR 363 potato
XP_009404256 387 WKRAVA 392 wild Malaysian banana
XP_010320937 371 AENAER 376 tomato
XP_014634413 367 LTNAEK 372 soybean
VDC68577     411 MARSEK 416 field mustard
Q8VYF6       384 MASSEK 389 thale cress
XP_009113820 365 VDEAEK 370 field mustard
ERN19847     425 MDKAEK 430 Amborella trichopoda
XP_002966121 313 MKRAED 318 Selaginella moellendorffii
EFJ06933     346 MKDAER 351 Selaginella moellendorffii
XP_006357566 364 LANADE 369 potato
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap