Conserved Protein Domain Family
ALG3

?
pfam05208: ALG3 
ALG3 protein
The formation of N-glycosidic linkages of glycoproteins involves the ordered assembly of the common Glc3Man9GlcNAc2 core-oligosaccharide on the lipid carrier dolichyl pyrophosphate. Whereas early mannosylation steps occur on the cytoplasmic side of the endoplasmic reticulum with GDP-Man as donor, the final reactions from Man5GlcNAc2-PP-Dol to Man9GlcNAc2-PP-Dol on the lumenal side use Dol-P-Man. ALG3 gene encodes the Dol-P-Man:Man5GlcNAc2-PP-Dol mannosyltransferase.
Statistics
?
PSSM-Id: 398745
Aligned: 143 rows
Threshold Bit Score: 422.653
Threshold Setting Gi: 220972878
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WGS:AAPU:GI19772-PA  49 LLIVLAEAVINVLVIQHVPYTEIDWVAYMQECEGFLN-GTTNYALLRGDTGPLVYPAAFVYIYSALYYLT---AHGS--- 121 Drosophi...
XP_015791176         32 ALLIIFEIFLNVYIVQRIKYTEIDWSTYMQQVKCFLN-GELNYANISGDTGPIVYPAGHLYIYSILYFLT---NQGT--- 104 two-spot...
XP_003113793         25 AILMIIEACLSHIVILKVKYTEIDWSTYMQQVECYVNkGIMNYTEIGGDTGPIVYPAGHLFLYRILYFLT---SSGR--- 98  Caenorha...
XP_004247435         31 IAILIADAILVALIIAYVPYTKIDWDAYMSQVTGFLE-GERDYSNLKGDTGPLVYPAGFLYIYSAIQYVT-----GG--- 101 tomato
XP_003554516         44 LALLFADAVLVSLIIAFVPYTKIDWDAYMSQITGFLG-GERDYRNLKGDTGPLVYPAGFLYIYSAFKYLT-----GG--- 114 soybean
O82244               37 FALILADAILVALIIAYVPYTKIDWDAYMSQVSGFLG-GERDYGNLKGDTGPLVYPAGFLYVYSAVQNLT-----GG--- 107 thale cress
jgi:MICPUN_68602      1 --LLLGECVLCGLIVWKVPYTEIDWRAYMDEVGGYLG-GERDYLKLKGDTGPLVYPAGFVYIYAWLKQLT-----GG--- 69  Micromon...
XP_003063992          3 RVLVVLDALLSVAIVRRVAYTNIDWNAYMGEARGYAS-GERDYAKLRGDTGPLVYPAGFLYLYDALRRVT---DDGA--- 75  Micromon...
jgi:OSTLU_47741      24 VALIAFELALCAVIIAKVAYTEIDWIAYMEEVHGYAR-GERDYTKLKGGTGPLVYPAGFVYAYKALYDLVgglERGTsar 102 Ostreoco...
EGG14602             50 LILFLGEIALNYLIVTKRAYTNIDWEAYMEQIDLFVN-GERNYMKLEGGTGPVVYPAGYIYVYTALYWLT---NLGQ--- 122 Cavender...
WGS:AAPU:GI19772-PA 122 NVRLAQYIYTGIYLLQMCLALRLYAKsRKVPPYMLVLTAFtSYRIHSIYVLRLFNDPVAVLLLYASLNLFMDSRWLWGTI 201 Drosophi...
XP_015791176        105 SIRLGQYFFVILYIFNLVAVFNIYNQvRKVPPYVLMMMSFtSYRIHSIYSLRLFNDPIAMFALYCSINLILYRHWKSAAF 184 two-spot...
XP_003113793         99 NIRLAQHLFQAFYLFNVFMVFRILQKtMRIPPIVLFLVTVtGYRIHSIFMLRLFNDPLAMMLFYVAMDRFLDRKWLVGCV 178 Caenorha...
XP_004247435        102 QVYPAQILFGFLYVLDLAIVLFIYLKtDVVPWWALSLLSL-SKRVHSIFVLRLFNDCFATTLLHAALVSIICQKWHLGLV 180 tomato
XP_003554516        115 QVYPAQILFGVLYIVNLAIVLAIYVKtDVVPWWALCLLSL-SKRVHSIFVLRLFNDCVAMTLLHAALLLFVHRRWNLGLI 193 soybean
O82244              108 EVYPAQILFGVLYIVNLGIVLIIYVKtDVVPWWALSLLCL-SKRIHSIFVLRLFNDCFAMTLLHASMALFLYRKWHLGML 186 thale cress
jgi:MICPUN_68602     70 DIFLGQCAFVGLYVIHLAIVLAVYAEaRCVPPWVLAALCL-SKRIHSIFVLRLFNDCFAMAFAYLAVFLFQRKRWVSGFV 148 Micromon...
XP_003063992         76 DVRRAQMIFVVVYAAHQAAAMAVTVKaRVVPPWALSLLCV-SKRIHSVFALRMFNDGVCSLVAWVAIWLAQSKRFVAAAV 154 Micromon...
jgi:OSTLU_47741     103 GVATAQVVFALVYAAHQALVFSMYAMcEIIPPWAYALLCL-SKRVHSIFVLRMFNDGVAMALAYGATTLFQRKRWIAGSV 181 Ostreoco...
EGG14602            123 DIRVAQWIFVALYLTLTLVVFFIYNRsKSVPAYALTFLCI-SIRVHSIFSLRLFNDGIAMLLFYVALLLIINYRWSFGCL 201 Cavender...
WGS:AAPU:GI19772-PA 202 FYSLAVGVKMNILLFAPALLLFYLANLGVLLTIVHLFICGLIQVVIAYPFLRTHPVEYLTGSFDLGRIFEHKWTVNYRFL 281 Drosophi...
XP_015791176        185 LFSIAVSIKMNILLFAPGLLLIFLEETGLRNTIKYLIICALTQILLGLPFLLTHPVSYITSAFNFGRVFLYKWTVNWRLI 264 two-spot...
XP_003113793        179 FYSVAVSIKMNVLLFAPALFFTLILNNTFQHTLGYLAVCGLIQLYVGGIFLFHDWKSYIQRSFDLGRVFMFKWTVNWRFL 258 Caenorha...
XP_004247435        181 IFSGAVSIKMNVLLYAPPLLLLMVKAMDIVGVISALAGAALVQILIGLPFILSHPASYLSNAFNLGRVFIHFWSVNFKFV 260 tomato
XP_003554516        194 LFSGAVSVKMNVLLYAPPLLLLMLKAMDISGVLLALSGAALVQILLGLPFLVSYPVAYISRAFNLGRVFIHFWSVNFKFI 273 soybean
O82244              187 VFSGAVSVKMNVLLYAPTLLLLLLKAMNIIGVVSALAGAALVQILVGLPFLITYPVSYIANAFDLGRVFIHFWSVNFKFV 266 thale cress
jgi:MICPUN_68602    149 AFSLGTSVKMNVLLMAPPALVLLVGGERLSVACAAVAAAVLTQLAVGYEFLSAHPASYVRRAFEFSRVFIHHWSVNFKFV 228 Micromon...
XP_003063992        155 ALSVAASVKMNALLFLPPFLVLLVGHERVSTACVAVGAFVGVQVVVGWPFLSTYPREYVGRAFELGRKFTYEWTVNWKFV 234 Micromon...
jgi:OSTLU_47741     182 VFSLGVSVKMNVLLMLPGLLVLLVGGTSAGTAIGAVAAIVGTQIALGAPFLATYPREYLSRAFELGRVFTHKWSVNFKFV 261 Ostreoco...
EGG14602            202 FFSLAVSIKMNVLLYAPALLLLLVQTFGFLGAIPKLVLCAVVQVVLAAPFLLYNPESYLNRAFEFSRQFLFKWTVNWRFI 281 Cavender...
WGS:AAPU:GI19772-PA 282 TRELFEQREFHLALLGLHLLLLLAFAkyTWTFFKSY--------------V---HLREvqqiilpqlmlknreekekaka 344 Drosophi...
XP_015791176        265 DEKLFLNRHFHLSLLTLHIFLLILFF--GKRYSRLL--------------S---SP-Rfwsknsfksiis---------- 314 two-spot...
XP_003113793        259 PEELFLDKRFHIALLVGHITVLGLFA--YYMWFRRL--------------N---GLPAslhirvfqg------------- 306 Caenorha...
XP_004247435        261 PEDIFVSKAFALSLLVAHLSLLLVFA--HYRWCRHE--------------G---GLFAvvrskiiqlklrvsq------- 314 tomato
XP_003554516        274 PEPVFVSRGFAILLLAAHLILLASFA--HYSWCKHE--------------G---GLCNflhsryvfmrmkfalflsss-- 332 soybean
O82244              267 PERVFVSKEFAVCLLIAHLFLLVAFA--NYKWCKHE--------------G---GIIGfmrsrhffltlpssl------- 320 thale cress
jgi:MICPUN_68602    229 PNETFVSPAFAAALLACHLTLLLALA--HRRWHRHGggffpafivdfftrAgsdSRPAtpaad----------------- 289 Micromon...
XP_003063992        235 SIETFSSDAFSLGLLLAHVAILFAFA--HARWYRRGggffpaffvdfferA---RTDAaaskrlk--------------- 294 Micromon...
jgi:OSTLU_47741     262 SEDIFVSKSFAKYLLLAHLVCLFVFA--HRRWCAREggfffnfvrdffkrLllrNVDGvqstf----------------- 322 Ostreoco...
EGG14602            282 PEDIFLSKPFALGLLTIHLLLLVIFL--LFKWTRPE--------------G---LFKSirfgewrnv------------- 329 Cavender...
WGS:AAPU:GI19772-PA 345 akkkshhrskskksqqqeqaqelepgnkeedeeeltaeqksflksfekglqnatgqkrppapvkeskrkpyeisfehctq 424 Drosophi...
XP_015791176        315 ----------------------------------------------------------------------ksnqekssnq 324 two-spot...
XP_003113793        307 ------------------------------------------------------------------------ihtrtgpl 314 Caenorha...
XP_004247435        315 -------------------------------------------------------------------rnpsstkkvlqad 327 tomato
XP_003554516        333 -------------------------------------------------------------fskkvgkssssslrilnke 351 soybean
O82244              321 ------------------------------------------------------------------sfsdvsasriitke 334 thale cress
jgi:MICPUN_68602    290 ----------------------------------------------------------------------------yapa 293 Micromon...
XP_003063992        295 ---------------------------------------------------------------------------sltaa 299 Micromon...
jgi:OSTLU_47741     323 -----------------------------------------------------------------------------tpa 325 Ostreoco...
EGG14602            330 ------------------------------------------------------------------------gerklnvr 337 Cavender...
WGS:AAPU:GI19772-PA 425 lALLPFFLCNFIGVVCARSLHYQFYVWYFHSLPYLVWST-----------------PY--SV------GVRFLILGGIEY 479 Drosophi...
XP_015791176        325 rILFTLFASNLIGITVARSLHYQFYVWYYHSLPYLIWST-----------------NY--ST------VSKLCLMGIIEF 379 two-spot...
XP_003113793        315 eTYYAFCTANLIGIAFSRSLHYQFYSWYFHQLPFLLF-Cdyp-----------evdSI--SKipwkqfFWKVPLLLAIEL 380 Caenorha...
XP_004247435        328 hIVTTMFVGNFIGIICARSLHYQFYSWYFYCLPYLLWKA-----------------PF--PT------LLRLFLFAAVEF 382 tomato
XP_003554516        352 hIVTTMFVGNFIGIVCARSLHYQFYSWYFYSLPYLLWRT-----------------NY--PT------LLRLILFVGVEL 406 soybean
O82244              335 hVVTAMFVGNFIGIVFARSLHYQFYSWYFYSLPYLLWRT-----------------PF--PT------WLRLIMFLGIEL 389 thale cress
jgi:MICPUN_68602    294 hVARVLFEGNFVGIVFARSLHYQFYEWYYHTLPLLLWGGsc--------------aSLpgGS------ATRVATMVAVEV 353 Micromon...
XP_003063992        300 dVVCAMAEGNFIGIVFARSLHYQFYAWYFHSLPLLLWSIssngsrrggkgggrlrrAL--AV------AARVGAMGAIEW 371 Micromon...
jgi:OSTLU_47741     326 hVALVLAQSNLIGIVFARSLHYQFYSWYFHTIPLLLWSNp----------------RV--PV------GAKLAIMGAIEW 381 Ostreoco...
EGG14602            338 yMLLVMFTSNLIGVTFARSLHYQFYVWYYHTIPFLLWQT-----------------RL--PV------VVRVAIIGAIEY 392 Cavender...
WGS:AAPU:GI19772-PA 480 SFNTYPSTNLSS 491 Drosophila mojavensis
XP_015791176        380 CWNIYPSTTFSS 391 two-spotted spider mite
XP_003113793        381 CWNVYPSTWWSS 392 Caenorhabditis remanei
XP_004247435        383 CWNVFPSNTCSS 394 tomato
XP_003554516        407 CWNIYPSNSLSS 418 soybean
O82244              390 CWNVYPSTPSSS 401 thale cress
jgi:MICPUN_68602    354 CWNVFPSTPTSS 365 Micromonas commoda
XP_003063992        372 CWNVYPSTPTSS 383 Micromonas pusilla CCMP1545
jgi:OSTLU_47741     382 CWNVYPSTPTSS 393 Ostreococcus lucimarinus CCE9901
EGG14602            393 CWYKYPSTNLSS 404 Cavenderia fasciculata
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap