1P4E


Conserved Protein Domain Family
Flp_C

?
pfam05202: Flp_C 
Click on image for an interactive view with Cn3D
Recombinase Flp protein
Statistics
?
PSSM-Id: 398741
Aligned: 2 rows
Threshold Bit Score: 410.223
Threshold Setting Gi: 31615976
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1P4E_C   136 NSHSKKMLKalLSEGESIWEITEKILNSFEYTSRFtKTKTLYQFLFLATFINCGRFSDIKNVDPKSFKLVQNKYLGVIIQ 215 baker's yeast
CCH59117 183 KFNQNVLEY--LNKNGDPWDIYSQCFAMFENHSRE-MSCIRYKLISVLTFTNACRISDLIRLDPSSFHLKKNKYLGTIVC 259 Tetrapisispora blat...
1P4E_C   216 CLVTETKTSVSRHIYFFSARGR-IDPLVYLDEFLRNSE-------PVLKRVNRTGNSSSNKQEYQLLKDNLVRSYNKALK 287 baker's yeast
CCH59117 260 GHTFNTLNNIPRTVQFIPAYTRgCDMLQLLEEYLKINKngpfeyvPMQNNKSPIQTTNDVNQKYQFFKEGVGAAYTKLMS 339 Tetrapisispora blat...
1P4E_C   288 KNAPYPIFAIKNGPKSHIGRHLMTSFLSMKGLTELTNVVGNFSDK---RASAVARTTXTHQITAIPDHYFALVSRYYAYD 364 baker's yeast
CCH59117 340 VHPAHHLFKLKNAPKTDLGIYLMINYLNKIGLQNEGHRLGNWTKVcpiDGSELKKRNFTTTLTPCHSVRDSTRAIISGYY 419 Tetrapisispora blat...
1P4E_C   365 PISKEMIALKDETN 378 baker's yeast
CCH59117 420 QISKYTNNNKKRMV 433 Tetrapisispora blattae CBS 6284
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap