
Conserved Protein Domain Family

pfam05192: MutS_III 
Click on image for an interactive view with Cn3D
MutS domain III
This domain is found in proteins of the MutS family (DNA mismatch repair proteins) and is found associated with pfam00488, pfam05188, pfam01624 and pfam05190. The MutS family of proteins is named after the Salmonella typhimurium MutS protein involved in mismatch repair; other members of the family included the eukaryotic MSH 1,2,3, 4,5 and 6 proteins. These have various roles in DNA repair and recombination. Human MSH has been implicated in non-polyposis colorectal carcinoma (HNPCC) and is a mismatch binding protein. The aligned region corresponds with domain III, which is central to the structure of Thermus aquaticus MutS as characterized in.
PSSM-Id: 398732
Aligned: 1100 rows
Threshold Bit Score: 80.151
Threshold Setting Gi: 2497997
Created: 20-May-2020
Updated: 7-Aug-2020
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
5YK4_B          273 ATRRNLEI-TQ----------------TLSG-----------------KkTP----TLFSILDGCATHMGSRLLALWLHH 314  Neisseria g...
XP_008184323    496 VKLELVLN-SSlna-----------knTLF--------------------------DVLNKCATIGGQRRLRSSILQPSS 537  pea aphid
BAF69631        311 NALEQLNI-I-----------------S--Rd----------------PdEM----TLLKLLDKTSTPIGKRVLKERLLN 350  Nitratirupt...
jgi:Sdel_0624   310 NALEQLDI-I-----------------S--Rn----------------PmEM----TLLNLIDQSSTAMGKRLLKERLLN 349  Sulfurospir...
jgi:Nitsa_0587  308 NALEQLGV-I-----------------S--Rd----------------PaEV----TLLELIDRSSTAFGKRLLKERLLN 347  Nitratifrac...
KDE06931        351 EALTSLQI--------------------FRDeshas-------thssaKkEGlslfGIMN---LARTGPGRALLRTWFLR 400  Microbotryu...
XP_007411006    129 DALRSLQI--------------------FDQeahan-------lhsnkTkEGlslyGILN---ECVTYSGRMLLKNWLIR 178  Melampsora ...
F4JEP5          188 AAHEALQI--------------------FQTdkhpsh-----mgigraK-EGfsvfGMMN---KCATPMGRRLLRSWFMR 238  thale cress
XP_005848992    248 ASMAALQIfQQeahpaaamgigqpkegF----------------------------SVFSTLNRCVTGAGRRLLRLWFRR 299  Chlorella v...
XP_963830       198 DALLSLQI--------------------LRTelhpnpqlqclggsenkVkESlsiaGLLQA--LAGTVQGKSKLRQMLFQ 255  Neurospora ...
5YK4_B          315 PLRNRAHIRARQEAVTALE-----SQ-YEPLQ-----CHLKS-IA------DIERIAA----------------RIAVGN 360  Neisseria g...
XP_008184323    538 DIRLIHNRQEAVEEILS-S-----PEqNFILL-----RNVL---QkftdveQLYWLCTkvskntqqlsklqgnyTLLL-- 601  pea aphid
BAF69631        351 PIQNQKELQRRYAMIEKFIp----HF--KEIE-----VLLKQ-IY------DIERILR----------------RIKLRK 396  Nitratirupt...
jgi:Sdel_0624   350 PICDLKTLNERFDLSSKLMe----DY--KKFD-----IALKQ-VY------DLERILR----------------RIALKK 395  Sulfurospir...
jgi:Nitsa_0587  348 PICDPEILNARYDLSERVAp----RS--EQFA-----TRLKQ-IY------DLERLGR----------------RIKLRR 393  Nitratifrac...
KDE06931        401 PLLDMEMIAARQNAVEC-FlraenQHiADAIQ-----SNLKR-IK------NAPAALR----------------ALGAGR 451  Microbotryu...
XP_007411006    179 PSTQLDIISARANAVQC-FldsenEHcAGRMR-----QYLKS-TG------NLARTTM----------------IVSSGK 229  Melampsora ...
F4JEP5          239 PILDLEVLDRRLNAISF-Fis--sVElMASLR-----ETLKS-VK------DISHLLK----------------KFNSPT 287  thale cress
XP_005848992    300 PIVNLAVLSDRLDGIQ---------F---FLCrpdavKPLQDmLRkv---rDAPRLLA----------------RLQG-- 346  Chlorella v...
XP_963830       256 PSIAIDVIEERQRSIAV-FlrpenSDiVQSIR-----RQLKK-VK------NIKAVLH----------------HVRGGV 306  Neurospora ...
5YK4_B          361 ARPRD-----------LAS-------L--------RDSLF-----ELAQIDLSATGSSLLETLKAvfpetlP-VA---ET 405  Neisseria g...
XP_008184323    602 KT--------------TLEalpalvdI--------L---EpfkseYIFSIRKTL--SNS--RYS-------K-MLeiiEI 644  pea aphid
BAF69631        397 AHPFE-----------INY-------L--------HTSLY-----YIEKLSNTLKSYDMGIEAFSi----eE-VYrfrKS 440  Nitratirupt...
jgi:Sdel_0624   396 LHPLE-----------LAY-------L--------STSLE-----AILGILKEAELKKMNLPKSLl----dE-TEalfSM 439  Sulfurospir...
jgi:Nitsa_0587  394 LHPVE-----------LTY-------I--------AMSME-----GIEGLFTLCRESGIEVDNALe----sE-SRefsRY 437  Nitratifrac...
KDE06931        452 GGSIEwn--------qILQfingsitI--------RDVVL-----SLAHRKGVSIVEKCLNSFSP------QvFEeigGK 504  Microbotryu...
XP_007411006    230 GRVGEwr--------sVLNfmraavnI--------CE--------ESKSFIDSDLKIGLISRISNsdq-htSeLNeqaKK 284  Melampsora ...
F4JEP5          288 SLCTSndw------taFLKsisallhVnkifevgvSESLR-----EHMRRFNLDI-IEKAGLCIS------TeLDyvyEL 349  thale cress
XP_005848992    347 -----------------------------------LQTLP-----DRADFLALQ--ASL--AGT-------L-------L 368  Chlorella v...
XP_963830       307 DRIRGqlslrindwraLLRftmlttqI--------REDIR-----SLVGGQDLNIYAKLQEDIDT------QgILqagEM 367  Neurospora ...
5YK4_B              --------------------------------------------------------------------------------      Neisseria g...
XP_008184323        --------------------------------------------------------------------------------      pea aphid
BAF69631            --------------------------------------------------------------------------------      Nitratirupt...
jgi:Sdel_0624       --------------------------------------------------------------------------------      Sulfurospir...
jgi:Nitsa_0587      --------------------------------------------------------------------------------      Nitratifrac...
KDE06931            --------------------------------------------------------------------------------      Microbotryu...
XP_007411006        --------------------------------------------------------------------------------      Melampsora ...
F4JEP5              --------------------------------------------------------------------------------      thale cress
XP_005848992    447 avirqelvlchnlisgvidgspaaaedgfiisagvspeldelreqyhalpdfltqlgqkghlwsivylpqvgfvvrvegg 526  Chlorella v...
XP_963830           --------------------------------------------------------------------------------      Neurospora ...
jgi:Sdel_0624   508 --------LESEGHYILMSKNRFALIEEKLMQSFLTIGDKHYFFKDFTFRHLKNSVKIS--ASLIEEIshditlnnlqmi 577  Sulfurospir...
jgi:Nitsa_0587  509 -----vgyLESEGYHLTLTKTRFNQIEKLLKESYVTLEGKHIFLRDFRFKILKSVVKIH--APIFEEItrrietdrvkli 581  Nitratifrac...
5YK4_B          531 ----------LKNL-RT-ALPQLQKAAKAAAALDVLSTFS 558  Neisseria gonorrhoeae FA 1090
XP_008184323    782 ----------LRKY-IS-CIYDLCNGIADLDLIFSFTQYS 809  pea aphid
BAF69631        577 alvkksytevLMEI-ELrYSALMEKLITFIGEIDFSISGA 615  Nitratiruptor sp. SB155-2
jgi:Sdel_0624   578 alvkerydemLEKI-EThFSLTLEHLISFVGTLDVALSNA 616  Sulfurospirillum deleyianum DSM 6946
jgi:Nitsa_0587  582 arvkerytlsLEEI-ERrHSLLLERLVAFIAEIDVAVSNA 620  Nitratifractor salsuginis DSM 16511
KDE06931        638 ----------LTQL-RE-HETTIIATAETLTELDCLLSFA 665  Microbotryum lychnidis-dioicae p1A1 Lamole
XP_007411006    418 ----------EAAL-AV-ISPILLNLASDMAELDCLLSLA 445  Melampsora larici-populina 98AG31
F4JEP5          488 ----------LSHT-LL-FSAHLLKAVNFVAELDCILSLA 515  thale cress
XP_005848992    593 ----------IARLaPY--APDIAAAGEAVAELDCILGLA 620  Chlorella variabilis
XP_963830       505 ----------AGAV-SE-HEDALIRALEVLGELDSLLALA 532  Neurospora crassa OR74A
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap