2QV6


Conserved Protein Domain Family
GCH_III

?
pfam05165: GCH_III 
Click on image for an interactive view with Cn3D
GTP cyclohydrolase III
GTP cyclohydrolase (GCH) III from Methanocaldococcus jannaschi catalyzes the conversion of GTP to 2-amino-5-formylamino-6-ribosylamino-4(3H)-pyrimidinone 5'-phosphate (FAPy). The reaction requires two bound magnesium ions for the catalysis and is activated by monovalent cations such as potassium and ammonium. The enzyme is a tetramer of identical subunits; each monomer is composed of an N- and a C-terminal domain that adopt nearly superimposible structures, suggesting that the protein has arisen by gene duplication. The family is found in archaea and bacteria.
Statistics
?
PSSM-Id: 147379
View PSSM: pfam05165
Aligned: 4 rows
Threshold Bit Score: 319.908
Threshold Setting Gi: 150421556
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2QV6_B   1 MiqiTVIQIDNYGPWTVTPNPRRESDLQALQSRLYADLNLMFGAHKGLVFYTRFDNLIAITNGIDLITHKRIQESIRNRY 80  Methanocaldococcus ja...
O27096   1 MiqmTLIQIDNYGPWTVTPTPRNEADLQIMQAELYADLQRQFAARQGLVFFTRFDNMLAVTNGMDLEDHRRIQKSIGNRY 80  Methanothermobacter t...
Q9YC89  15 V---------GYREWTEELGSDREWIIQTLQSDIYAAAQKEAAGYGGFVLPIRYDIMLLISSNMGVQEHARVLDAIAGLS 85  Aeropyrum pernix K1
Q9HQS9   1 M---AAVQIDDYGPWTTEPAPRRETDLQALQARLFADVADFLGGRDGYAFAGRFDNMVGAATGIAPAAFERLQERIRNRY 77  Halobacterium salinar...
2QV6_B  81 PFTVSMVIASAETPYEAQKLATETLQEYGSAQDENRKEVLDVaNEL---VVDGYVQIAHIDINNITGTLTDIVSAYDTYL 157 Methanocaldococcus ja...
O27096  81 PITVSMGVGAAETPYDAQRNASRALQSHGGAQSEERKEVLAI-DGL---VDEGYVQIAHIDINGITETMTDIVPAYDTSF 156 Methanothermobacter t...
Q9YC89  86 KVKVRMASYCGVKPLDAVERAWNALRRREERLIYERCE------------GEEYTAIAHIDLNNVT-AITRAEGPVRTYY 152 Aeropyrum pernix K1
Q9HQS9  78 PVTVSVGIGTARTPADALDAAGTALRDAGSAQDENRQEALSHrSPPgfaGTPGAVTIAHFDVVDATGTYTDTVSPVRAGT 157 Halobacterium salinar...
2QV6_B 158 NVNKVKLALMEEL-LKYNALLFFIGGDNFMAPSNGMSEEDFLDIFNRINKKYKI-----ELKAGIGIGRTAEDASNLADI 231 Methanocaldococcus ja...
O27096 157 IVNRVQHFLMKKL-IKEGALLFFIGGDNFMSPCNGLEPQGLLRIINEIDDEINV-----ALKAGIGKAPTAEKAANLADL 230 Methanothermobacter t...
Q9YC89 153 EVMDLMAKISKVA-EKIGAITQYLGGDNILA---------VLPLNGSVKETVDMllvrsDLKAGIGIAPTARASLALAAE 222 Aeropyrum pernix K1
Q9HQS9 158 EIQGAVTTLAEYLyDTHDAVTQFVGGDNAIAVCPEIDAGIVDDATAHVREAAGV-----DFQVGVGHGDTPHDAGADAKH 232 Halobacterium salinar...
2QV6_B 232 GLEKIR--GKLVDKNVCTLKQ 250 Methanocaldococcus jannaschii
O27096 231 ALEEIR--GGFTYDLVHVMKE 249 Methanothermobacter thermautotrophicus str. Delta H
Q9YC89 223 ALHEIR--SKINPGPLVVKAQ 241 Aeropyrum pernix K1
Q9HQS9 233 ALETCRatGARVHGPWTTADD 253 Halobacterium salinarum NRC-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap