2HUO


Conserved Protein Domain Family
MIOX

?
pfam05153: MIOX 
Myo-inositol oxygenase
MIOX is the enzyme myo-inositol oxygenase. It catalyzes the first committed step in the glucuronate-xylulose pathway, It is a di-iron oxygenase with a key role in inositol metabolism. The structure reveals a monomeric, single-domain protein with a mostly helical fold that is distantly related to the diverse HD domain superfamily. The structural core is of five alpha-helices that contribute six ligands, four His and two Asp, to the di-iron centre where the two iron atoms are bridged by a putative hydroxide ion and one of the Asp ligands. The substrate is myo-inositol is bound in a terminal substrate-binding mode to a di-iron cluster. Within the structure are two additional proteinous lids that cover and shield the enzyme's active site.
Statistics
?
PSSM-Id: 398701
Aligned: 19 rows
Threshold Bit Score: 435.974
Threshold Setting Gi: 268553803
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2HUO_A              41 LDRVFTTYKLMHTHQTVDFVSRKRIQYG-SFSYKKMTIMEAVGMLDDLVDESDPDVDFPNSFHAFQTAEGIRKAhPDK-- 117
Q5REY9              37 LDRVFTTYKLMHTHQTVDFVRSKHAQFG-GFSYKKMTVMEAVDLLDGLVDESDPDVDFPNSFHAFQTAEGIRKAhPDK-- 113 Sumatran ...
Q9VTU9              34 KERVRQTYRQMHLNQTVDFVKGRREHWL-KFNTIKMTVREALEKLNDLVDESDPDLDLPNIIHAFQAAERARAEfPEH-- 110 fruit fly
Q16XZ8              44 KERVRRTYKLMHTHQTVDFVKGRHADWL-KFDHFKANIRDALERLNDLVDESDPDLDLPNIVHAFQTAERAREEyPEW-- 120 yellow fe...
WGS:AAAA:OsI_23379  58 KETVEEFYRVNHINQTYDFVRRMREEYG-RVDKTEMGIWECIELLNEFIDDSDPDLDMPQIEHLLQTAEAIRKDfPDE-- 134 long-grai...
O82200              67 QQGVEEFYRMQHIHQTYDFVKKMRKEYG-KLNKMEMSIWECCELLNNVVDESDPDLDEPQIQHLLQTAEAIRRDyPDE-- 143 thale cress
Q9FJU4              64 QKSVEHFYATQHTNQTLDFVQKMRSEYG-KLDKMVMNIWECCELSKEVVDESDPDLDEPQIQHLLQSAEAIRKDyPNE-- 140 thale cress
Q6CNQ4              71 KDRVREFYKEQHEKQTMAYNLQARINFK-TKVRARMTVWDALCQLSKLIDESDPDTELSQIDHALQTAEAIRND-GKP-- 146 Kluyverom...
Q54GH4              39 EDRVSEAYRNSHTYQTYDYATEKKKQYSqLDTSIKMGLWEAAELLNTIIDESDPDSNIPQINHCLQTAEAIRKVyPDSky 118 Dictyoste...
NP_001093275        45 KERVRRTYYLMHSNVTVDLVKQKREKWL-KFNHFKATVKDALIKLNELVDESDPDTDLPNIVHAFQTAERIREDhPDE-- 121 domestic ...
2HUO_A             118 DWFHLVGLLHDLGKIMAL--W-GEPQWAVVGDTFPVGCRPQASVVFcDSTFQDNPDLQDPRYSTELGMYQPHCGLENVLM 194
Q5REY9             114 DWFHLVGLLHDLGKVLAL--F-GEPQWAVVGDTFPVGCRPQASVVFcDSTFQDNPDLQDPRYSTELGMYQPHCGLDRVLM 190 Sumatran ...
Q9VTU9             111 DWLHLTALIHDLGKIMAF--Y-GEPQWAVVGDTFAVGCRWGDSIVYrDESFEGNPDGDNPAYNTELGIYQPNCGVDNLLM 187 fruit fly
Q16XZ8             121 DWLHLTGLIHDLGKVMAF--Y-GEPQWAVVGDTFPVGCEWGPSIVYrEDSFVDNVDGANPKYNTKTGMYQPKCGLQNLTM 197 yellow fe...
WGS:AAAA:OsI_23379 135 DWLHLTGLIHDLGKVLLHpsFgELPQWSVVGDTFPVGCAFDECNVH-FKYFKENPDYLNPKLNTKFGAYSEGCGLDNVLM 213 long-grai...
O82200             144 DWLHLTALIHDLGKVLLLpeFgGLPQWAVVGDTFPVGCTFDSANIH-HKYFKGNHDINNPKYNTKNGVYTEGCGLDNVLM 222 thale cress
Q9FJU4             141 DWLHLTALIHDLGKVLTLpqFgGLPQWAVVGDTFPVGCAFDESNVH-HKYFMENPDFNNPKYNTKAGIYSEGCGLENVLM 219 thale cress
Q6CNQ4             147 RWMQLVGLIHDLGKILYF--FeSEGQWDVVGDTFPIGCGFVKENIF-PEFFQGNPDNSHPIYSTKLGIYEENSGLKSVMI 223 Kluyverom...
Q54GH4             119 DWFHLTGFIHDLGKVLLSkkFkEQPQWATVGDTFPLGCKFDESNIF-YEFFKMNPDYNDSKYNSECGIYKKNIGLENVTM 197 Dictyoste...
NP_001093275       122 DWFHLTGLIHDLGKVMAF--Y-DEPQWCVVGDTFPVGCKWADSIVYgPESFKDNPDTYNPKYNTKYGMYKPHCGIDNLLM 198 domestic ...
2HUO_A             195 SWGHDEYLYQMMKfNkfSLPSEAFYMIRFHSFYPWHTGGDYRQLCSQQDLDMLPWVQEFNKFDLYTKCPDLPDVESLRPY 274
Q5REY9             191 SWGHDEYMYQVMKfNkfSLPPEAFYMIRFHSFYPWHTGSDYQQLCSQQDLAMLPWVQEFNKFDLYTKCPDLPDVDKLRPY 270 Sumatran ...
Q9VTU9             188 SWGHDEYMYSVLKhNktKLPHVACNIIRFHSFYPWHNGGDYKHLEAPQDAETKKWVLIFNRYDLYTKSEVVPDIEALWPY 267 fruit fly
Q16XZ8             198 SWGHDEYLYRVLKhNksTLPEQALYMIRYHSFYPWHSGGDYEHLTTEKDEEIKNWVLLFNRYDLYTKSTKKPDMEALWPY 277 yellow fe...
WGS:AAAA:OsI_23379 214 SWGHDDYMYLVAKeNktTLPSAGLFIIRYHSFYPLHKHGAYMHLMNDEDKENLKWLRVFNKYDLYSKSNERIDVEKVKPY 293 long-grai...
O82200             223 SWGHDDYMYLVAKkNgtTLPHAGLFIIRYHSFYPLHKAGAYTHLMNDEDRDDLKWLHVFNKYDLYSKSKVLVDVEQVKPY 302 thale cress
Q9FJU4             220 SWGHDDYMYLVAKeNgsTLPSPGLFIIRYHSFYPLHKAGAYTHLMNEEDKENLKWLHVFNKYDLYSKSKVHVNVEKVKPY 299 thale cress
Q6CNQ4             224 SWGHDEYMYYIAK-NqsTLNEKALAMIRYHSFYPWHREGAYRYLMSESDYEILEAVQDFNQYDLYSKGLQKHNRDELKPY 302 Kluyverom...
Q54GH4             198 SWGHDEYFYLVCVgNkcLLPKESLYMIRFHSFYPWHRHNKYTHLTNEEDEKMLNWVKEFNKFDLYSKDSEPVDVESLKPY 277 Dictyoste...
NP_001093275       199 SWSHDEYLYQFLLhNksTIPEKGLYMIRYHSFYPWHAGGDYRHLSNEKDEEILKWVTEFNKYDLYTKSEKVPDIEALWPY 278 domestic ...
2HUO_A             275 YQGLIDKYCPG-TLSW 289
Q5REY9             271 YQGLIDKYCPG-ILSW 285 Sumatran orangutan
Q9VTU9             268 YQTLIDKYLPG-VLEF 282 fruit fly
Q16XZ8             278 YQGLIDKYCPG-ELEW 292 yellow fever mosquito
WGS:AAAA:OsI_23379 294 YMSLIEKYFPA-KLRW 308 long-grained rice
O82200             303 YISLINKYFPA-KLKW 317 thale cress
Q9FJU4             300 YMSLIKKYFPE-NLRW 314 thale cress
Q6CNQ4             303 YLELIDEFFPQkLVEF 318 Kluyveromyces lactis
Q54GH4             278 YQSLISKYFPN-ELHW 292 Dictyostelium discoideum
NP_001093275       279 YEKLIEKYIPG-ICEW 293 domestic silkworm
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap