Conserved Protein Domain Family
AbrB

?
pfam05145: AbrB 
Transition state regulatory protein AbrB
Bacillus subtilis respond to a multitude of environmental stimuli by using transcription factors called transition state regulators (TSRs). They play an essential role in cell survival by regulating spore formation, competence, and biofilm development. AbrB is one of the most known TSRs, acting as a pleotropic regulator for over 60 different genes where it directly binds to their promoter or regulatory regions. Many other genes are indirectly controlled by AbrB since it is a regulator of other regulatory proteins, including ScoC, Abh, SinR and SigH. Hence, AbrB is considered a global regulatory protein controlling processes such as Bacillus subtilis growth and cell division as well as production of extracellular degradative enzymes, nitrogen utilization and amino acid metabolism, motility, synthesis of antibiotics and their resistant determinants, development of competence, transport systems, oxidative stress response, phosphate metabolism, cell surface components and sporulation. AbrB is a tetramer consisting of identical 94 residue monomers. Its DNA-binding function resides solely in the N-terminal domain (AbrBN) of 53 residues. Although it does not recognize a well-defined DNA base-pairing sequence, instead, it appears to target a very weak pseudo consensus nucleotide sequence, TGGNA-5bp-TGGNA, which allows it to be rather promiscuous in binding. The N-terminal domains of very similar sequences are present in two more Bacillus subtilis proteins, Abh and SpoVT. Mutagenesis studies suggest that the role of the C-terminal domain is in forming multimers.
Statistics
?
PSSM-Id: 398696
Aligned: 133 rows
Threshold Bit Score: 139.207
Threshold Setting Gi: 81543895
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Theco_3286       31 WILGAAFAVMVLNTV-RPGLAAWPRLMGDAGVAVVAYVLGSAMTFETVRTIAQGLPAMLLAAALWTAVCTAIGLLFAKAT 109 Thermoba...
jgi:HIMB59_00005260  34 WLLGSLFANLLIAFTkLK--VSFSNKLLNPIFLLIGIILGGTLNVTLLHKVHLWIFSSVMMILYVLFSTYVVYCYFYKFA 111 alpha pr...
bosiu:SAR11G3_00796  34 WLLGALIANLVFSFTkFE--IKFDKKIFLPVLLVIGVILAGSFNISLLYKIHLWIFSSIAMIICTIIGSIVTAFYLYKIC 111 Candidat...
Q89US0               44 lisGSMIAVGIAAIA--GRQLTLPPILTQTVLVLLGISLGSVVSRHLIQQVSAYPLTICLLALATFCSTFGSSYYLQRVH 121 Bradyrhi...
EGP08790             46 lisGAMIAVGAAAIA--GRPMGLPPLMAHIVLMTLGLSLGSMVSPQMLTNMASYPISIAILAASTFCATMGSSYYLQRIH 123 Bradyrhi...
Q21BN7               37 liTGAMIAVASVGMA--GRPLGLPQPMAHAILMTLGLSLGAMVSPQLIKNLSAYPMTIALLALATACSTLVSSLYLQRIH 114 Rhodopse...
Q6NCD0               33 liTGAMIAVGAAGLA--GRKMGLPPPLSHIVLMALGVSLGSVVSPTMVHNLASYPVTIGLLAVATFCATFGSSIYLQRVH 110 Rhodopse...
WP_013164935         42 WLSGALVATGIAALA--GAPVGVERNIRLATYILLGTSMGSAVTPDTLHGITTWPVTMLVLIVSVPVMMVAVVFYLERIA 119 Starkeya...
jgi:Xaut_0301        37 WISGALVVSIALAVA--GVRIAVPEWIRFLAFIVLGTSMGTALTPETFARAATWPISMACLGASVLATMAGGALFLNRVA 114 Xanthoba...
BAF90686             38 WMSGALVAVTLWVLA--GRPAVVPAPLRILTYVVLGASMGGALTPQSLAQASAWPLSMGFLVLNVVAVVAACVFYFRRVA 115 Azorhizo...
jgi:Theco_3286      110 GLSVQDGVLGSMPGGLTQMVLLAdQ--MRGADAGIVAIMQTSRLIVVLYMVPFLAALFAGGPAALGGAAGAAAGGgigig 187 Thermoba...
jgi:HIMB59_00005260 112 KFSKSTSVFSSLPGALAPITAAIlEm-KNFSEHKSIILIQATRVIFIVGLLPIIFFYERGAVDIggfgfinn-------- 182 alpha pr...
bosiu:SAR11G3_00796 112 KFKKVVAILAGLPGAFVVIAGALeDlaDNKKDRARVIIPQATRVLFIVLFVPFIFLASEGYQEIgandykat-------- 183 Candidat...
Q89US0              122 GWDRTSAFLAGSPGALSQITILAvE--R-GADLPGIAVVQTMRVIILTAALPMVLAFAGVAPSAAPSLTTAIASPl---- 194 Bradyrhi...
EGP08790            124 RWDRTSALLAGSPGALSQIIMLAnE--R-RADVAGIAVVQTMRVIILTAALPLILAASGLAQHSGSSIHAAPATPl---- 196 Bradyrhi...
Q21BN7              115 GWDRTSALLAGSPGALSQIVMLAsE--R-KADVPGIAVVQIMRVIILTAGVPLFLTATGMMAHGPLPSRGIAATPl---- 187 Rhodopse...
Q6NCD0              111 GWDRTSALLAGSPGALSQIIMLAtE--R-KADVPGIAVVQVMRVIILTSAVPMLLALIGMAGHGALPSRGPEATPl---- 183 Rhodopse...
WP_013164935        120 GWDRRSAFFAAAPGALSTVLVMAeT--S-GADTRRVVFGQSIRLFILVTLLPPTLGGFGHEPAGTLPINPVVPDLa---- 192 Starkeya...
jgi:Xaut_0301       115 GWSRETAFWASAPGAFGTVVAMAaD--T-SADLRKVAFAQALRLFLLVAALPNVLGATGLTAGGLPPPPHVSTALe---- 187 Xanthoba...
BAF90686            116 GWDLASALYASTPGALSAVMALAeS--T-SADLRKVAFSQGLRLFLLVVGLPNLLNVIGLDAAAPPAAVAAEPMVg---- 188 Azorhizo...
jgi:Theco_3286      188 addgtagiaadgvaaaasaadgvwtglppwagYAALPLVPlaAWLAR-RIHLPAGEFLGPVLAVGALAAAGFPWPSMPAV 266 Thermoba...
jgi:HIMB59_00005260 183 ------------------------ydlryfgeIIFIVVLCsfGALLIkKFKIPSATLLSGMLISGTFYTFEIIDARFPDI 238 alpha pr...
bosiu:SAR11G3_00796 184 ------------------------ynlryfseLVFLLGIShlLSILLeRFTIPSAPILAAMLAAGFFYTLEITTAKFPPL 239 Candidat...
Q89US0              195 -------------------------------dLVELVAASlaAALILrLVRFPASWMFGAMIASSVLHGAGWVEGGLPNW 243 Bradyrhi...
EGP08790            197 -------------------------------aLALLVAGCvaTALALrLLKFPASWMFGAMLGSSILHGTGTIEGGLPAW 245 Bradyrhi...
Q21BN7              188 -------------------------------aLAELAAVGvaAALLLrLVNFPASWMFGAMLGSAVLHGAGWVDGTLPQW 236 Rhodopse...
Q6NCD0              184 -------------------------------vLAVLIAVAvgVALLLrLVNFPASWMFGAMLGSSVLHGGGWVEGTLPQW 232 Rhodopse...
WP_013164935        193 -------------------------------tALLSIGVGiaGAFIAeRIRFPGGAMVGAMLASALVHGFGLIEGRLPDI 241 Starkeya...
jgi:Xaut_0301       188 --------------------------------VAILLGVCvtTGLGAaWLKVPGGLILGALAGSAALHATSLSSAVLPQA 235 Xanthoba...
BAF90686            189 --------------------------------LAELLAASaiLGLLFdRLHVPGGLLLGAMAASAALHISGLSTAHIPAV 236 Azorhizo...
jgi:Theco_3286      267 LLAAAQLAIGIYIGQRVQPRILLTNRRFGPLSLLSACLLVALTALAAWGLSAAAGGSVATWFLALAPGGLGEMAVTALVL 346 Thermoba...
jgi:HIMB59_00005260 239 FINIAFVFLGTALGSRLNGLKLNELGKYLFHGVIMSILLIFLSALFSYLLSFIDGFEFLPTFLSFTPGGIHEMIIISVAY 318 alpha pr...
bosiu:SAR11G3_00796 240 FINIAFVFLGSAIGCRLNGLGIKEIIFYSFHGAVISILLLGIAAIFAYFLNIWFGFDFIATLLSFAPGGLHEMVIISAAY 319 Candidat...
Q89US0              244 VRGVALIGIGALIGSRFARMRIKTLAGHINAALGSFAVAIAVSAIFVGIVALTTQVKFSDVVVAFAPGAMDAMLALALTL 323 Bradyrhi...
EGP08790            246 AYAAALIGIGALIGTRFARISARTLLSHMAAALGSFSVAIVISAIFVAIVAMTTSARFGDIVVAFSPGAMDAMLALALTL 325 Bradyrhi...
Q21BN7              237 AYVAALTGIGTLIGARFSKIRTRTIVSHIGAALGSFAVAMTISACFVAAIAFTMPVRIGDVVVAFSPGAMDAMMALALTL 316 Rhodopse...
Q6NCD0              233 AYLAALVGIGTLIGARFGAIKPRTILSYIGAALGSFAVAIAISAVFVVAIMLTTPVKLNDLVVAFSPGAMDAMMALALTL 312 Rhodopse...
WP_013164935        242 FLIIGFVVLGANTGSRFAGTKIRTLRHFLVDSMVALAIATLVALAFAFLGSWLAGEPFTKVLLAYVPGALEAMTIMAFVL 321 Starkeya...
jgi:Xaut_0301       236 FIVPAFVVLGASVGVRFLGTTLGTIRAYFFASLGAFLVAVSISTLFALLAAWLTGDDLGKLVTAFAPGALEAMTALGFAL 315 Xanthoba...
BAF90686            237 LMIPAYVVLGASVGVRFAGTRMDTLKANIIASLGGFAVAMVISAAFSILAALATGEDTGKMLTAFAPGALETMTALGFAL 316 Azorhizo...
jgi:Theco_3286      347 DADESRVTAYQLCRLLFVLLAAPPLLKL 374 Thermobacillus composti KWC4
jgi:HIMB59_00005260 319 DIDPIFVSYHHFLRIFLIVFSLPLLVKL 346 alpha proteobacterium HIMB59
bosiu:SAR11G3_00796 320 NIDPLFVSYHHFLRVFFIIFAIPFIVKF 347 Candidatus Pelagibacter sp. IMCC9063
Q89US0              324 HIDPIFVGAHHLSRFVFVTIATPGIVHL 351 Bradyrhizobium japonicum
EGP08790            326 HIDPIFVGAHHLSRFVFVSIATPGIVHL 353 Bradyrhizobiaceae bacterium SG-6C
Q21BN7              317 HVDPVFVGAHHLARFIFVSLVTPGIIHL 344 Rhodopseudomonas palustris BisB18
Q6NCD0              313 HIDPVFVGAHHLSRFIYVSIVTPGIVHW 340 Rhodopseudomonas palustris
WP_013164935        322 GLDPAFVAAHHLTRFLGLALAIPLVTRM 349 Starkeya novella
jgi:Xaut_0301       316 GYDPAFMSAHHLFRFAGLSVALPVAARL 343 Xanthobacter autotrophicus Py2
BAF90686            317 GYDPAFMSAHHLFRFVGLSVALPFAShl 344 Azorhizobium caulinodans ORS 571
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap