Conserved Protein Domain Family
DUF702

?
pfam05142: DUF702 
Domain of unknown function (DUF702)
Members of this family are found in various putative zinc finger proteins.
Statistics
?
PSSM-Id: 398695
Aligned: 53 rows
Threshold Bit Score: 148.67
Threshold Setting Gi: 242045392
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAD54064     130 GTSCQDCGNNAKKDCSHLRCRTCCRSRGFSCATHVKSTWVPAAKRRERqqqlaalfrGAAannsaaa---------aaaa 200 Japanese rice
XP_006605571 115 TSTCQDCGNQAKKDCSHRRCRTCCKSRGFDCSTHVKSTWVPASRRRER---------QLKgvaaagaav-----gsngat 180 soybean
XP_009391542 115 ESTCQDCGNQAKKDCSHRRCRTCCKSRGFECSTHVKSTWVPASRRRERhvaaass---------------------fast 173 wild Malaysian ...
XP_006854799  73 TTTCQDCGNQAKKDCLHRRCRTCCKSRGYDCATHVKSTWVPAARRRER---------HMAaavtgeg---------aagv 134 Amborella trich...
XP_006356361 139 TTTCQDCGNQAKKDCTHRRCRTCCKSRGYDCNTHVRSTWVPASRRRER---------QLLggatttnvnvvaagsssqst 209 potato
XP_025881073 106 AATCHDCGNQAKKDCVHHRCRTCCKSRGFDCPTHVRSTWVPAARRRER---------QQLagaassppts--safpaatt 174 Japanese rice
XP_002969095 367 GATCKECGNQAKKDCQFQRCRTCCKSRNYDCSTHVKSTWVPAAKRRER---------QALeaaaiaa---------gqpr 428 Selaginella moe...
XP_001755786  75 STACQECGNQAKKDCSFQRCRTCCKSRDFDCATHVKSTWVPASKRRER---------QAAeaaaaaa---------gqpr 136 Physcomitrella ...
CBI24237      98 GTTCQDCGNQAKKDCSHRRCRTCCKSRGFDCATHVKSTWVPAARRRER---------QLMvsvtpgag-------ssgst 161 wine grape
XP_009414171 120 SATCQDCGNQAKKDCSHRRCRTCCKSRGFECSTHIKSTWVPAARRRER---------LRtalasg------------ssa 178 wild Malaysian ...
BAD54064     201 aaSKRPRELVrtlgrlpsantamvatttssgtppi---ltptlsimvtltltppwlcagegdgRFPPELSVEAVFRCVRI 277 Japanese rice
XP_006605571 181 sgAKKPRLVAsqttshtstsnnttpp---------------------rsfdtgcspqdvgfkeSLPSQVRAPAVFKCVRV 239 soybean
XP_009391542 174 saSKKPRLVAsqpatashtstpnttpp--------------------rsfdttsshqdagaieNLPGHVRAPAVFKCVRV 233 wild Malaysian ...
XP_006854799 135 ggGKKPRLAAssqgtshtstsantpprs------------------fdtgsshqdvnystgsgSLPSRVRAPAVFKCVRV 196 Amborella trich...
XP_006356361 210 ssAKKPRLVNsqttttashtstsnntp-------------------prsfdtssshqdasfkgSLPGQVRAPAVFKCVRV 270 potato
XP_025881073 175 asAKKPRLLGsqtttttsrtstsnatt-------------------prsfdtssshqvasfrdALPRHVRAPAVFRCVRV 235 Japanese rice
XP_002969095 429 prSKRTRSLAlgggsssaaaqvgggmtanpssllglpgpssprssadlpvflplytaassyrgVLPPEVRAQALFKCVKV 508 Selaginella moe...
XP_001755786 137 pkSKRARTITlaapagattsmtttsansp----------------rgsdinsghpsqpaqgrgGLPPEVRAQALFKCVRV 200 Physcomitrella ...
CBI24237     162 sgAKKPRLITsqttttshtstsnttpp--------------------rsfdtssshqdasfkeALPGQVRAPAVFKCVRV 221 wine grape
XP_009414171 179 stSKKPRLVAslpatashtftsndnppg------------------scdatsgheasdasireSLPGQVRAQAVFRCVRV 240 wild Malaysian ...
BAD54064     278 GAVDE-ADAELAYQTAVSIGGHTFKGILRDHGPAD 311 Japanese rice
XP_006605571 240 TSVDDgGEDEYAYQAVVKIGGHVFKGFLYDQGVED 274 soybean
XP_009391542 234 TSIDD-GEDEYAYHAVVKIGGRVFKGFLYDQGLDD 267 wild Malaysian banana
XP_006854799 197 SSIEDdGEDEYAYQAVVKIGGRIFKGVLYDHGAAt 231 Amborella trichopoda
XP_006356361 271 TSVDE-GEDEYAYQAVVKIGGHLFKGFLYDQGLDE 304 potato
XP_025881073 236 TSVDD-GDDEFAYQAAVTINGHMFRGFLYDQGADD 269 Japanese rice
XP_002969095 509 TGIED-GENEYAYQATVKIGGHVFKGVLYDQGVEa 542 Selaginella moellendorffii
XP_001755786 201 TGVED-GENECAYQATVKIGGHIFKGLLYDQGLDl 234 Physcomitrella patens
CBI24237     222 TAVDD-GEDEYAYQAVVKIGGHVFKGFLYDQGLET 255 wine grape
XP_009414171 241 TSIHD-SKDQYAYHAVVKIGGRVFKGLLYGQGVhd 274 wild Malaysian banana
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap