Conserved Protein Domain Family
ResB

?
pfam05140: ResB 
ResB-like family
This family includes both ResB and cytochrome c biogenesis proteins. Mutations in ResB indicate that they are essential for growth. ResB is predicted to be a transmembrane protein.
Statistics
?
PSSM-Id: 398693
Aligned: 198 rows
Threshold Bit Score: 237.493
Threshold Setting Gi: 552841824
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011800079      27 MRFSISLLTVICIASIIGTVLKQQEPLSN--YVNQF---G-----PFWAQVFSLASLNTVYSAWWFLLILAFLVVSTSLC 96  Polaromonas...
CCK80050          36 VKLTVYLLVLLASTSIIGTVILQNGTGQQ--YVKLY---G-----EAFYKLIKVLNIDDMYNAWWFLALIFMLCINIVVC 105 Desulfobacu...
EIM64633          30 vKLTVYTLVLLALTSIIGTVVLQNGTPEA--YMRLY---G-----PGLYNMIQVLDLDRMYQAWWYLLLMVVLCVNIVVC 99  Desulfobact...
jgi:Sfum_0696     18 LKLTLFIFLALAFASLVGTLLPQGLTAEQ--LEQRF---S-----PGVVHWIQTLGLHDLYRAGWFRVLLFLLCLNLVVC 87  Syntrophoba...
Q1ITP7            19 LRTGITLLILVVIAAAIGTFILQRPTTDAdkIAQAY---S-----PTALYWLDRLTLTDIFHAWWFATLLALVSVSIVCA 90  Candidatus ...
jgi:MICPUN_75305  10 LPLAIGEFLVIAGFSALGTVIEQN--KGAawYVQNYpvdEpa-fgFIDYPFILNFGLDHIYTEWYFLALLGALAASLTAC 86  Micromonas ...
AAB95196         124 RAIAI--MALIAVLSGLGTFIPQN--KSIeyYLVNYpdgAekvlgFLTGDLILTLQLDHIYTADYFYLSMGLLAASLAAC 199 Chlamydomon...
XP_005850413      11 LKLALGELAVIGALSAVGTTIKQG--EPYsyYAQNYpeeGrrvlgFLTGRIIWALQLDHIYTADYFLLLLALLGASLAAC 88  Chlorella v...
CBK40613          37 iKLAMFLFIVLAMTATIGTVIQQGERPET--YVQEY---G-----EEAYRWFLRLGFTDVYHTWWFTSLLGLLCVNSLTC 106 Nitrospira ...
WP_014450300      61 LRLAISLFLILAFLTIFGTFIEQGRDAPF--YIAGY---G-----EKWGGWIVRLKVDDIYHSWYYVSLLTILCINAVSC 130 Leptospiril...
WP_011800079      97 IARNTPKILADFSqLKEDVREQSLKAFGHRAqaALAESP---EAaaRRIG-----QTLVQSGWK-VKLqqrn-agwMVAA 166 Polaromonas...
CCK80050         106 SIERLSFTWKIIFpKKITFNPERFRKLKNCEafTVDKDA---SSlsEAYE-----SVLFKTIGK-VIKeknd-tgiMMYA 175 Desulfobacu...
EIM64633         100 SVDRLSVTWKIIFpKNISVNPERFEKTKNRQqfECQLSM---DRfaREAK-----QMLAARAGK-VIEktse-tglILYA 169 Desulfobact...
jgi:Sfum_0696     88 TLQRLPKTIKLVRhREEEIKPEKLVKFSLHRqlTSGLPW---TGtkSCLQ-----ETINEVFGG-LKPfeggdksfSGTA 158 Syntrophoba...
Q1ITP7            91 SIDRWPNAWRFYArPYRKPDPHFRAVLPNHTelPIADPKlalNV----AE-----KALLELGYKpERIvda--dhvSLYS 159 Candidatus ...
jgi:MICPUN_75305  87 TFTRQLPVWRVSAdWKFLDRPATLLKMEES--------EtlpR-----ARssdlaSLLARRGYQ-VFVkg-----kKMYA 147 Micromonas ...
AAB95196         200 TYTRQWPAVKVAQrWRFLTQPKSLLKQGRT--------EvlpN-----ARvsdlgAILLQRGYQ-VFVkd-----gSLYG 260 Chlamydomon...
XP_005850413      89 TSTNQWPAVKVAQrWRFKGDADALARLQVA--------SllpN-----ARladlgRALQGQQYQ-VFLkd-----gCLYG 149 Chlorella v...
CBK40613         107 FHKRFPSVWRSMRqDKVSVSLAFIQGMKQQTtlSLNQSR---DAvaERLV-----KLFAEKGYR-VLAksdp-gevTVYA 176 Nitrospira ...
WP_014450300     131 VYNRFPITLRSMFhEKVNVSREFLKKQREFAdlSIPSSRf-pAGpgDYLK-----TVLSSKRYK-VTEirdg-gdvVVFG 202 Leptospiril...
WP_011800079     167 KKGAVNKLGYIAAHSAIVLICIGGLLDGDmivraqmllngkstytgggliadvpaahrlsernPTFR--------ANLLV 238 Polaromonas...
CCK80050         176 EKGRWTRIGVYVVHSSILLLLIGALIGSV----------------------------------FGFK--------ANLQL 213 Desulfobacu...
EIM64633         170 EKGRWSRLGVYVVHSSVLMLLAGALIGSA----------------------------------LGFK--------ANLRL 207 Desulfobact...
jgi:Sfum_0696    159 EKGRWSRLMVYGVHLSVLLILFGAMLGSV----------------------------------LGFK--------GFMNI 196 Syntrophoba...
Q1ITP7           160 EKNRFSVMAVYVVHASLLLIFLGGIIDAV----------------------------------VGYR--------GFMAI 197 Candidatus ...
jgi:MICPUN_75305 148 FKGLIGRLAPIGVHAGLLLTLGGAAYSGL----------------------------------GGLG--------GSVMV 185 Micromonas ...
AAB95196         261 FKGLAGKLGPIGVHAALLLCLFGTAWSGF----------------------------------GTLK--------GNVMC 298 Chlamydomon...
XP_005850413     150 FKGLAGKLGPIGVHASMLLCMAGFATGAL----------------------------------GGFT--------GSVMI 187 Chlorella v...
CBK40613         177 TKGIMGRVGAHVAHLSATVIVLGGLLGSY----------------------------------YGFQefgvclegQTYHI 222 Nitrospira ...
WP_014450300     203 HKGVMGRIGSHVAHMSVILILAGGLIGSL----------------------------------LGFRlfgtfyvhSTTFV 248 Leptospiril...
WP_011800079     239 SEGTQSSTAiL-NQPGGVLLQE-----LP----FAVELKKFSVEYYSTGMPKLFASDIIIHDka--sgEKTPARVEVNHP 306 Polaromonas...
CCK80050         214 DEGETSDTVfVvK---KRVPVK-----LD----FSIRCNDFDVKFYDTGAPEEFKSNLTIIEng---kESFTKDILVNHP 278 Desulfobacu...
EIM64633         208 DEGQTADTVfDtH---TRLPIK-----LP----FTVRCNSFQVKFYDTGAPDEFKSSLTILEnn---qESFTEDILVNHP 272 Desulfobact...
jgi:Sfum_0696    197 VEGTSSNEVvLlS---GNETLT-----LP----FTVRCEKFDVSFYDTGAPKEFRSDLTIVQgg---rDVLKHALLVNDP 261 Syntrophoba...
Q1ITP7           198 VNHQSNNTI---------ELRDggkkvLP----YAVVCNDTGQERYEDGTPKKWWSKLAVVRdg--kvVQ-EKEIVVNDP 261 Candidatus ...
jgi:MICPUN_75305 186 PEGTEFQIGa--GLRRGAPFAP-----TPavakDIVRVNDFTIEYLPNGQVSQFFSDLSVVDskng-reiQRKTISVNVP 257 Micromonas ...
AAB95196         299 PEGQDFQVAs--FLQPSSPIAS-----MPasasNVIHVNKFTIDYRPDGSVAQFYSDLSLLDpaqggkemMRKTISVNDP 371 Chlamydomon...
XP_005850413     188 PQGSEVLVAs--ALRSASPLAW-----SPrgaeALLRCDDFRIDVRPDGSIRQFYSDVSVLDleg--nqlASKTVSVNQP 258 Chlorella v...
CBK40613         223 PRGN-----------------------------FDLRVDKFWIDYHENGSVKSYNSTLTVIDqg---tPTTTKTITVNDP 270 Nitrospira ...
WP_014450300     249 PQGD-----------------------------FSLRVNKFWIDHYPNGMVKGFFSDVDVLKsg---kIIDHKVISVNHP 296 Leptospiril...
WP_011800079     307 ANYKGVEIYQSSFddggssvtlkaipmsaaskafeiqgtiggisaltngqgpgaeqltleytalrlinvenfagsnggvs 386 Polaromonas...
CCK80050         279 LRYKGINIFQSSYgtakpdrvqldmiqhsdnhvtskivkig--------------------------------------- 319 Desulfobacu...
EIM64633         273 LRYKGINIFQASYgattpdearfeitdsetgtveihtikng--------------------------------------- 313 Desulfobact...
jgi:Sfum_0696    262 LEYDGITLYQASYgsilneadvefedldsgkvykmtlpy----------------------------------------- 300 Syntrophoba...
Q1ITP7           262 LVYDGLRFYQASWgmtgdldqvsivaepfeggspqtvglslnkav----------------------------------- 306 Candidatus ...
jgi:MICPUN_75305 258 LREGGVTMYQTDWei----------------------------------------------------------------- 272 Micromonas ...
AAB95196         372 FRFNGVTMYQTDWsl----------------------------------------------------------------- 386 Chlamydomon...
XP_005850413     259 LRFGGVTAYQTDWsm----------------------------------------------------------------- 273 Chlorella v...
CBK40613         271 LVYKGIWFYQSSYgdawdqieaarinikekgsdkiiatvdlewnkeka-------------------------------- 318 Nitrospira ...
WP_014450300     297 LETNGLRFYQASYgeawdrvdkarilivnkekkqflgqvmlkggalsp-------------------------------- 344 Leptospiril...
WP_011800079     387 gsgadvrkvdlhqaietrlgaanktvtqkqlrnvGPSISYKLRDAAgqaREFQnyMLPVkmdDSaDNpAM-FLMGVREnP 465 Polaromonas...
CCK80050         320 ------deiqlpqdqglfklegflphfdfrghnlGEAFIGRITQNDg--------------------------------- 360 Desulfobacu...
EIM64633         314 ------gvvslpagagnfifegfvphydfnghnlGEAFIGRLDTIDg--------------------------------- 354 Desulfobact...
jgi:Sfum_0696    301 ---------reivtvpdtrdqvqiinfqkdfsrfGTAVAIMMRKEGq--------------------------------- 338 Syntrophoba...
Q1ITP7           307 --nldpqttvtmfefipdffvrdnqifrrsndpvNPAFHLKVNRAG---TESLvwLMPAyknTTeDQkSP-FKFSLTEgP 380 Candidatus ...
jgi:MICPUN_75305 273 -----------------------------------aSMQVRVAEVGfktEDAAatSQGDsgpAPeAEdSAtSGSASVElP 317 Micromonas ...
AAB95196         387 -----------------------------------sAVTLRVLGQDaplARAAqaAEAQaaaSTsGPtSSaSSTSDAL-- 429 Chlamydomon...
XP_005850413     274 -----------------------------------sALQLRVEGSAv--------------------------------- 285 Chlorella v...
CBK40613         319 vdglplkmkmtdfvadfafnstekkvfsktaehaNPAIRLAVDERS---------------------------------- 364 Nitrospira ...
WP_014450300     345 apgtdlsikilryvadfafdpktnsvyskseksdNPAIQLGIYQNG---------------------------------- 390 Leptospiril...
WP_011800079     466 VDAFQYLRIPADpeS-STa---------TFV--R--------------------------LRAALADPAQRElavkryar 507 Polaromonas...
CCK80050             --------------------------------------------------------------------------------     Desulfobacu...
EIM64633             --------------------------------------------------------------------------------     Desulfobact...
jgi:Sfum_0696        --------------------------------------------------------------------------------     Syntrophoba...
Q1ITP7           381 GA------------------------------------------------------------------------------ 382 Candidatus ...
jgi:MICPUN_75305 318 EGAGESLSLPMAnlEgKGnfqg----------------------------------riwgTFLPLNPDSSD--------- 354 Micromonas ...
AAB95196         430 PQQRTAFNLPMAslEgKPgvag----------------------------------rlwaTFLPLAEPGQDG-------- 467 Chlamydomon...
XP_005850413     286 APADTPIQLPMAslSgERgggrltprgrRRLlcSllpsaatcaralsstaaaggdsklyaTFLPMEDPARGA-------- 357 Chlorella v...
CBK40613             --------------------------------------------------------------------------------     Nitrospira ...
WP_014450300         --------------------------------------------------------------------------------     Leptospiril...
WP_011800079     508 lavgtdrpelarqlsesasralalfagaeavpvagasaakvkpvaglqaisdfmeanvpeaersragevlvrilngvlfe 587 Polaromonas...
CCK80050             --------------------------------------------------------------------------------     Desulfobacu...
EIM64633             --------------------------------------------------------------------------------     Desulfobact...
jgi:Sfum_0696        --------------------------------------------------------------------------------     Syntrophoba...
Q1ITP7               --------------------------------------------------------------------------------     Candidatus ...
jgi:MICPUN_75305     --------------------------------------------------------------------------------     Micromonas ...
AAB95196             --------------------------------------------------------------------------------     Chlamydomon...
XP_005850413         --------------------------------------------------------------------------------     Chlorella v...
CBK40613             --------------------------------------------------------------------------------     Nitrospira ...
WP_014450300         --------------------------------------------------------------------------------     Leptospiril...
WP_011800079     588 ltamtreqaglkPLPQDE-------KTQafMSQMVl-sLsdapHYPAPMVFE----------LKDFKQVQASVFQVARAP 649 Polaromonas...
CCK80050         361 --------------KSFQigi--pvK-----FPTFd------kMRKGTFAFV----------IKEFEKKYYTGLQITKDP 403 Desulfobacu...
EIM64633         355 --------------RNVQivl--ptK-----FPTFd------kMRKGRFTVE----------VKSWDQAYYTGLQVTKDP 397 Desulfobact...
jgi:Sfum_0696    339 --------------KAAGswi--laD-----RPDFh------gNRIENYKIK----------VTRMGQSYYTGIQVKKDP 381 Syntrophoba...
Q1ITP7           383 ------------------------------------------------MRMVh-----------------YTGLEVSHQP 397 Candidatus ...
jgi:MICPUN_75305 355 ------------PVEAKRgvtllarDFQsvAIYASdgsFagvrRPGSGRPIEvdglrlvvenMKG-----STGLELKTDP 417 Micromonas ...
AAB95196         468 --------------SAPKgisilarDPQsvVFYDAkgqFvgvrRPGSGKPIEveglalvvedVTG-----ATGLELKSDP 528 Chlamydomon...
XP_005850413     358 ------------PGAAPRgvsilarDLEtvSFYDSrgqFvgvrRVGSGKAIQvdgltirpeaLLG-----ATGLELKADP 420 Chlorella v...
CBK40613         365 --------------SVQStpwv------fyhYPDLf------eIKDSAYQFE----------FIGYQPKKFTGLQIARNP 408 Nitrospira ...
WP_014450300     391 --------------KQIGspwl------fynFPQIq------vMKSLPYFFI----------LGGYEAPMYTGLEVAKDP 434 Leptospiril...
WP_011800079     650 GKKIVYLGCAFLILGVFGMLYIRERRLWVWL-APqkhtpegsnddstgsgdavhsvsesAGKSQATMALSTNRKTMDGDK 728 Polaromonas...
CCK80050         404 GIWYVYSGFILMIIGCWITFFMSHQSCYIEIkSSq------------------------GNGSKVFVSGSTNRNRQGMKL 459 Desulfobacu...
EIM64633         398 GVPFVYTGFLLMIIGCWVTFFVSHQSVCIGLeQTg------------------------SGSTRVWVAGRANRNAQStnl 453 Desulfobact...
jgi:Sfum_0696    382 GVWVVLFGFTLMVVGIGLTFYTSHRRLWVHAePVtg----------------------aDALSKVIIAGRTSKNTDGFEE 439 Syntrophoba...
Q1ITP7           398 GQWAIWAGVLLMGVGLGVAFYMVHVRFWIMPvETk------------------------DGQLVLWIGGSANKNKDKFEE 453 Candidatus ...
jgi:MICPUN_75305 418 GVPWVYAGFAGLMVTSFLS-LLSHSQVWAVQ-SEg------------------------GGGTVLHVGGRSNRAKEEFKS 471 Micromonas ...
AAB95196         529 GVPAVYAGFGGLMVTTLIS-YLSHSQVWALQ-Q----------------------------GSSLFVSGRTNRAKLAFDR 578 Chlamydomon...
XP_005850413     421 GVPLVYAGFGGLCITTVVS-YLSHSQVWAAQ-A----------------------------GSGVMVGGSTNRAKVMFER 470 Chlorella v...
CBK40613         409 GINMVWIGCTMLVVGMTLSSLIYHRRLWAKIiPG-------------------------ESGVTLHLGGTTHKSQIDFQK 463 Nitrospira ...
WP_014450300     435 GVHVILAGSFLLVGGLFLSSFVYHRKLWVRAkEN-------------------------SGVWQLSVGGFGHKDKLGFEK 489 Leptospiril...
WP_011800079     729 E 729 Polaromonas naphthalenivorans
CCK80050         460 K 460 Desulfobacula toluolica Tol2
EIM64633         454 t 454 Desulfobacter postgatei 2ac9
jgi:Sfum_0696    440 E 440 Syntrophobacter fumaroxidans MPOB
Q1ITP7           454 K 454 Candidatus Koribacter versatilis Ellin345
jgi:MICPUN_75305 472 E 472 Micromonas commoda
AAB95196         579 E 579 Chlamydomonas reinhardtii
XP_005850413     471 E 471 Chlorella variabilis
CBK40613         464 E 464 Nitrospira defluvii
WP_014450300     490 E 490 Leptospirillum ferrooxidans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap