Conserved Protein Domain Family
Phage_portal_2

?
pfam05136: Phage_portal_2 
Phage portal protein, lambda family
This protein forms a hole, or portal, that enables DNA passage during packaging and ejection. It also forms the junction between the phage capsid and the tail proteins.
Statistics
?
PSSM-Id: 398689
Aligned: 88 rows
Threshold Bit Score: 209.817
Threshold Setting Gi: 506396353
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Oant_1505            41 SSRLNGN--WR-SSGTSADAEIGSAGARLRNRMRELVRNNPHAANAVTQLVTHIVG-DGIMPRakt-------------- 102 Ochr...
WP_014118375             54 RSKAFRG--SK-GISADPQSDIDANHQTLISRSRLAYMTAPIATSAINTTRTNVIG-GGLHLKsrldweflntvtpfdqs 129 Osci...
PRJNA437124:C6362_07135  30 esNILKA--YN-PRKYSAKSDVNANLYTLRNRSADQSINTPIGAAAIMTSSLHTIG-AGLHLFprpkykll----gmtad 101 Mega...
WP_011877564             41 YKKSMRG--WK-TTAASPKDDIDINLATLRARSRDLYMNSPLGSAALKTSRTNVIG-PGLRLKahidaafl----gltdd 112 Desu...
WP_013387491             48 vkNALKA--FF-TKKGGPDKDIVENLELLRQRSRSLYMGVPIAAGILKKYRTSVVG-QGLVPKpnlnsenl----gisee 119 Ilyo...
CBL02812                 44 TKKSMRG--WQ-FAGGDAKSDIEDNLKTLRERSRDAYMGVPIATGALKTMRTNVVA-GGLTPSpqidaefl----gmtpe 115 Faec...
CBK99130                 41 HKKSMRG--WM-WHGGSPKEDIEDNLRVLRERSRDAYMGVPLATGAIKTMRTNVVC-GGLTPTpqidnafl----gisde 112 Faec...
CCK81206                 36 lRGTLSN--WFvSRNTAYSARM--ERQVIADRAEDLAANDTHAASSIDSIAVNSVG-TGLQPQsrpnakvl----gwnev 106 Desu...
Q727I3                   52 RGTLSNYrpWR-PSLVAGGQ----ERTTASTRSEDLVANDWAGRSMVDTITLNAVGaNGLFPQstipaall----gldee 122 Desu...
CCX53601                 37 skAANRG--YI-ADSKDARHDIDNNFKMLRARSVDLQQGVPIAAGALKTNKTNVIG-PGLRLKanirfeal----glsve 108 Veil...
jgi:Oant_1505           103 gddAKDKKVNDLFDEWSK--KADADG--GLDFYGLQTLAIRGMIESGDGII---------RRRrrtrkdklpVPLQLQVL 169 Ochr...
WP_014118375            130 haeNWENKIEREFALWAEskFCDAFR--LNNFYEMQSLFFLGELMNGDGLCllpm-eeptAFMp--------YGLRLKLI 198 Osci...
PRJNA437124:C6362_07135 102 esrEWSRHVAQEFDLWASstQCDLTR--RNNFYDMQDINYTGYLVDGDAFClfkr-rpptADMp--------YSLRLQLL 170 Mega...
WP_011877564            113 qaeAWERKTEREFALWAEskHCDALR--MNDFYDLQGIAFLGCLLNGDAFVlfka-aqrqSWMp--------YTLRLHVI 181 Desu...
WP_013387491            120 earKIEKQLKREFNAWAKsqNADAMR--MHNFYVLQGLVMLSWVMNGDVFVipkl-karkGVK---------NKLCVQVI 187 Ilyo...
CBL02812                116 qanTLQMQILREFSLWADspMCDADR--VDNFYKLQQLAFLAYMMNGDAFAvlpm-rhniGQP---------YDLRVQLI 183 Faec...
CBK99130                113 eaqKINEQIAREFALWANkpTCDADR--IDNFYMLQQLAFTGFLLNGDSWAvlqn-kktpGVP---------YDLRVRII 180 Faec...
CCK81206                107 qsrEFQTQAEWAWHIWQQe--sDAAG--RLSFWQNCLVAIRTMLIKGEFFRiplm-inrpGRV---------FSLALQAV 172 Desu...
Q727I3                  123 qarDIGDRMESIFRLW-----CESAGleGQHFADLQFMGLRSTLVHGEMLHipvm-vdatKEGg-------fLGLRMQPV 189 Desu...
CCX53601                109 aknEWERKTEQEFAMWAR--NCDARQ--QTDFYGLQALVFFEKMLYGDAFVnlpmiqhrkDP----------YYLRLQVI 174 Veil...
jgi:Oant_1505           170 ETDMIDS--------------------AKEgpl---------sagNIAVQGIEFDAEGRRANYWLFQ-SH---PGNTYLD 216 Ochr...
WP_014118375            199 EGDRLSTpg----------------tiMSAgriattywgtdkmtgNRIYSGVEFNRSGATVAYHFCN-RYpyaPMQPDSL 261 Osci...
PRJNA437124:C6362_07135 171 EGNRVSNpygrdyygitgpyavemtapTPG---------------NKIISGVEIDPDGAVAAYWVSN-KV---PGDPVDI 231 Mega...
WP_011877564            182 ESDRVSTpwvdvllf-----lvegrnpENG---------------NAIISGVEIDSDGMVVAYWICN-TYsivTGIEANK 240 Desu...
WP_013387491            188 EADRIKNplg--------------------------------sldEAIKEGVEIDEDGEIAAYHIAN-KH---PGDAT-- 229 Ilyo...
CBL02812                184 EADRVCSp---------------------DlddrlfpcvvddravDSIVQGIETDESGMVLAYWICN-QH---PLSSMAA 238 Faec...
CBK99130                181 EADRICSp---------------------AfmdilsptdinehhvEKIVQGVETDADGMVIAYWVCD-RH---PLASTSV 235 Faec...
CCK81206                173 DPLRVYTps----------------dlTEK---------------ENIKDGVEFGEYGMPTGYWVAD------PDDAFIN 215 Desu...
Q727I3                  190 HPERLCTpsdk-------------------------------ramHNMRDGVELDRLGRPCALWVAE-PA---PDLWSGR 234 Desu...
CCX53601                175 ESLLVATppkyqg--------------------------reeekdNDIIHGVKFGKYGEAVGYYVLTaPY---TGYNQ-- 223 Veil...
jgi:Oant_1505           217 pr----sALISKPVAAK-------DIAHVFEKQRT-QVRGVPWGSPVMSPIHDLGEYEGAEIVRKKIESCMVGILVRKne 284 Ochr...
WP_014118375            262 e------PMKWERVEAFgtqtgrpNVLHMFEPERAeQRRGVPFLSPILEELQQLKQYEKAELTAAIIGAMFTAFVVTDgp 335 Osci...
PRJNA437124:C6362_07135 232 g-----tIATWTRVKAWgdicgmpNIIQTSNDQRPeQYRGAPYLSPVIETLKQVSRYTTAELTAAIVKSFFSLFFTESqt 306 Mega...
WP_011877564            241 m-------kKWTRVEAFgadtgrpNVLHLLDAERAeQRRGVPLLAPVIEALKQITRYTNAELMAAVVSGLFTVFIKSEgp 313 Desu...
WP_013387491            230 -------VTETVRVEAYnkf-grrNILHIFEPERPdQRRGVPLLAPVIESLKQIGRYSEAELMAAVVSGMFTVFIEQGve 301 Ilyo...
CBL02812                239 tp----ePMKWQRVEAYgkttgrrNILHIMNRERSgQRRGVPMLAPVLEALKQLGRYTDAEITAAVISAMFTVFISKKtp 314 Faec...
CBK99130                236 tg---ltASHWTRVEAYgkktgrqNVLCLMQRERAgQLRGVPLLAPVLESLKQLGRFTDAELTAAVISAMFTVFIKKSdq 312 Faec...
CCK81206                216 yd---laSCDFTKVRAKagh--rpGAIHNFIAKTEeQVRGVSILAPAMKFFKDLNDYLEFEVVGAIIASSFPVFIETSdp 290 Desu...
Q727I3                  235 lgwgalgSDSFRRIPHRlfh--rpGAFHCFRRTSEeQYRGEPILSPALKLFRHLADSLEYELIGQIVAASFPLFIKVAdg 312 Desu...
CCX53601                224 -------DEDYTYIRKYgektgrrNIVHVLNIERSgQIRGVPLLAPVIEDIKLLGRYTDAEVVKVLVNALMSVFIETPtp 296 Veil...
jgi:Oant_1505           285 d-------------------egLgipvkaddVVRKPGVYDGSG--YPVE----RFEPGMFAFAEGADDIKFNTPA-ANSQ 338 Ochr...
WP_014118375            336 tt--------------------------gmpIGEAIDDEDAQQtaPPKGddeyRLGSGAIVTLAPGEDVKFAEPKhPVTA 389 Osci...
PRJNA437124:C6362_07135 307 sggt---------------------------lndfigKTIDPQggPVIDpdeyALGPGTINALPRGVDVKSIDASrSMST 359 Mega...
WP_011877564            314 ssemplg-------smlpqeeqVa-----------sEDPtv-----------yEMGGGAINVLQPGEDIVTANPSrPNTQ 364 Desu...
WP_013387491            302 deei----------------------------dpgqygMDEEEraFREEsekiELGNGAINILKPGEKVNSANPGrPNAN 353 Ilyo...
CBL02812                315 slgrplg-------evippnqqId-----------aQDRgt-----------iELAAGAIIDLNENEEVQFADPKhPNTG 365 Faec...
CBK99130                313 sdevpfg-------emlppdvqVd-----------tPDKts-----------vELAPGAFIDLNPGEEVQFADPKhPTTG 363 Faec...
CCK81206                291 ygtaegmrsa---------------------------------dpnaektryhesVPGTVLYGNINEKPHVLKSDrPGNS 337 Desu...
Q727I3                  313 tqgvedylgqfqqgpggqggqeRvyh--------------------------qsyAPGQVLYGNPGDDVKPLSSDrPGAN 366 Desu...
CCX53601                297 de------------------------------gppIDGIDYAEqvDTEHedtiELGNGTINVLGPGETVKTVEKSpIPSD 346 Veil...
jgi:Oant_1505           339 YEAYKRAMLHTIAAGFRIPYFLLTGDLSqASYASSKIGIEPFARLVSAVQ 388 Ochrobactrum anthropi ATCC 49188
WP_014118375            390 FGEFVSSVSQSIGAALEIPNELLLKKFS-TSYSASRGALLEAWKMFRFRR 438 Oscillibacter valericigenes
PRJNA437124:C6362_07135 360 FDAFTTKLLEMVGSAIGQPYEVLMKHFT-SSYSASRAAMLQAWEEYKRRR 408 Megasphaera elsdenii DSM 20460
WP_011877564            365 FEAFVNALTRYIGAALEIPYELLQKSFQ-SSYSASRAALLEAWKMFRTRR 413 Desulfotomaculum reducens
WP_013387491            354 YKLFVDSIYEEIGSGIEMPKEVMLNHFT-SSYTAARASLEEAWRRFLSVR 402 Ilyobacter polytropus
CBL02812                366 FDAFSTAIIRQIASALEIPSEVLMKQFT-ASYSAARGALNEFWRTCDMMR 414 Faecalibacterium prausnitzii SL3/3
CBK99130                364 FEAFMNAIVKQMAAALEIPSEVLYKQFS-TSYSAARGALNEFWRTTGMHR 412 Faecalibacterium prausnitzii L2-6
CCK81206                338 FDAFVERILRAIGASIGMPYEVIAKDFSkTNYSSARAALLEAGRVFAMYQ 387 Desulfobacula toluolica Tol2
Q727I3                  367 WTGFVNFVVRAMGASAGIPYEALLKDFSkTNYSSARAALLEAWRVYMLWR 416 Desulfovibrio vulgaris str. Hilden...
CCX53601                347 FDKFVTALTSQIGAALEIPYEILIKHFS-SSYSASRGALLEYWKSVDAAR 395 Veillonella sp. CAG:933
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap