Conserved Protein Domain Family
Phage_cap_P2

?
pfam05125: Phage_cap_P2 
Phage major capsid protein, P2 family
Statistics
?
PSSM-Id: 398682
Aligned: 38 rows
Threshold Bit Score: 364.235
Threshold Setting Gi: 1722791
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_013831780      8 LFKSYVSQIALLNGIDVEDa--vTKFSVSPAVEQTLEEKIQESSDFLSEINIVGVPQQTGQKVGVTVTRPMASRTDTAg- 84  Novosphingob...
P51720            5 AYYALAAALAKHFNQPLDSvlrgESFALKAPEAALLGENIQQRSDFLKQINMIQVAHTKGQKLFGATEKGVTGRKQT--- 81  Haemophilus ...
WP_014205476     11 cllAYSSQVIANAGVQEGs----LMFNLTPPMETKLRQAIMQSDSFLGQITLLPVQQITGQVVDVGQDGLSTGRAA---- 82  Vibrio furni...
WP_014292208     12 lLDKYSARLAQAYGIDTSKl--eQQFSVTGPQETRLRAALLESADFLRMITLADVDQIKGQVVDVGIGSIHSGRKAS--- 86  Oceanimonas ...
ACR69431         18 KFSDTFNDCGRSGd---------MQFTLTEPRAIALRKALLESTEFLRLINLMDVPHPQGQVVTVGESTLRTGRVKD--- 85  Edwardsiella...
WP_012987559     10 fLQNYSVGLAKAYGVTDTs----RYFALSDPKETALRAALLESVEFLNMITCADVDHLSGQVVSVGNPGLFTGRKKD--- 82  Xenorhabdus ...
IEC:ABF-0018455  25 YLSAYSAGLAQEYGVADTa----RYFALTDPKETQLRAALLERVDFLSMINVLDVDQLSGQVVSVGSSALHTGRKEG--- 97  Dickeya dada...
jgi:Ddes_0241     9 farevlSALAQGYSVPSVg----EHFAIEPSVAQRLNDKIVEQSTFLPRINIVPVDELVGENLLGYAKEPVTSRTDTSg- 83  Desulfovibri...
WP_013513408      8 KFSELCAALAEGYGVETAKv--tQGFTVAPTVEQRLQDAITEQSEFLPLINVITVSELVGQNVLGSASGPVSGRTDTKvd 85  Pseudodesulf...
Q15Y13           11 nFAVMLGLMAQTYGVDSVa----ETFSATPEVHQMLMDKIVLQSSFLQQINVMPVTEIKGQKILGSASGLVTTRTNTTg- 85  Pseudoaltero...
WP_013831780     85 GNRRTPTDPTDTgDNGSYFCRQTNYDHAIKYAKLDAWRH--KPQ-FQTLLRDVILKQQGRDRIMIGFNGTSAAASTDVVA 161 Novosphingob...
P51720           82 --GRNLANLDH--TQNGFELAETDSGIIVPWALFDSFAI--FKDrLVELYSEYFQNQVALDILQIGWNGQSVADNTTKAD 155 Haemophilus ...
WP_014205476     83 --ERFSVEVGQ--EGNTYTLVKTDSGSHIKWETMTQWANsgSKDeWMKMMKAAISRRFALDMLRIGFNGTSVAAITNPVE 158 Vibrio furni...
WP_014292208     87 --GRFIKAVGV--GGHNYELTETDSGALLSWATLAVWANagNEGeFLRLVNEFINRSFALDMIRVGFNGTSIATNTDPEA 162 Oceanimonas ...
ACR69431         86 --GRFTKGSGI--SGNEFRLVETDSCCVITWAQLAIWANagTPGeFFNLMNSTAVINFALDMLRIGFNGTHAAENSNPTD 161 Edwardsiella...
WP_012987559     83 --GRFMRATGI--DGNEYKLVETDSGAALKWDLLSIWANsgSEEeFFLRMQAFTNESFALDMLRVGFNGQRIAETTNPDE 158 Xenorhabdus ...
IEC:ABF-0018455  98 --GRFIRQVGV--EGNDYKLVETDSCAALPWDLLSVWANagGEDeFFQLVQAFSNEAFALDMLRIGFNGNSVAKSTNPDK 173 Dickeya dada...
jgi:Ddes_0241    84 SGERKPKDVLGL-GKYDYQLHKTDSDVAIRYNTIDVWAK--FPD-LADHYARYVQERIAADRELIGWYGERAVATTDLVA 159 Desulfovibri...
WP_013513408     86 GNERTPRDVLGL-GSFPYQLYQTNSDVYIRYDTLDAWAK--FKD-FAERYTRYVQERIANDREMAGWYGVDAAADTDMTA 161 Pseudodesulf...
Q15Y13           86 AGERKGRHLLDL-DAQGYELHQTDMDTALLYSMIDSWAK--FPD-LADRYANYINRAIATNKAMIGWHGTSVAATTDPTA 161 Pseudoaltero...
WP_013831780    162 NPLLQDVNEGWLHKIRT-HAG----SRVLNDGDLSVdptkaiyvaagvEVVD-GD--ATntasaeaDYANLDALAFDAL- 232 Novosphingob...
P51720          156 ---LSDVNKGWLKLLQE-QRA----ANFMTESTKSSg-----------KITIfGD--NA-------DYANLDDLAFDLK- 206 Haemophilus ...
WP_014205476    159 NPLGQDVNKGWLTLVKE-KKA----AQVLA------------------TAVL-DP--TGtt---edSYKNLDSLAQDLIn 209 Vibrio furni...
WP_014292208    163 NPLGQDVNKGWQQLVREwNGG----SQIIGSAQS--------------KVYF-DPdgNG-------DYNTLDAMASDLIn 216 Oceanimonas ...
ACR69431        162 YPSGEDINIGWHQIARNwGDNegrvSRILTT-----------------PVTV-GE--GG-------DYISLDAMASDLIh 214 Edwardsiella...
WP_012987559    159 NPNGEDVNKGWHQIAKEwNGG----KQVITT-----------------PVTL-DQ--HG-------DHKSLDSMASDLIn 207 Xenorhabdus ...
IEC:ABF-0018455 174 NPNGEDVNIGWHQRMKDfKDG----QQIITD-----------------RVVL-DE--NG-------DYKSLDAMASDLIn 222 Dickeya dada...
jgi:Ddes_0241   160 NPLMQDVNKGWLQYMRD-NLP----ANILTEGEHAG------------EIRI-GK--GG-------DYSCLDVAINDMV- 211 Desulfovibri...
WP_013513408    162 NPLLQDVNKGWLQYMRA-HLP----ANILIEGATTG------------EIRI-GT--TG-------DFANLDHAVSDLL- 213 Pseudodesulf...
Q15Y13          162 NPMGQDVNKGWLQILRE-QAA----AQVLTEGDTAG------------KVIL-GA--SG-------DFENLNSIVHGAL- 213 Pseudoaltero...
WP_013831780    233 DLLDPWHRSDTDLVVIVGWKLVKDKYLNLLQa--AGETATEREAAHRILTlPKQLAGKRAVIVPFFPETSMLITSLDNLS 310 Novosphingob...
P51720          207 QGLDFRHQNRNDLVFLVGADLVSKETKLIQQkhgLTPTEKAALGSHNLMG---SFGGMNAITPPNFPARAAAVTTLKNLS 283 Haemophilus ...
WP_014205476    210 TTIAPEHREDPDLVVMVGHNLVSAEQHRLLE---SANTPTEHKAAQTLAK---TIAGRTAITPPFFPANGIWVTNTKNLQ 283 Vibrio furni...
WP_014292208    217 STIDPAFRNDPRLTVMVGADLVAAAQGRLYQ---QADKPTEQIAAQQLAT---SVAGRRAITPPFFPGKRMVVTIPANLH 290 Oceanimonas ...
ACR69431        215 ASIPPQYHNDPRLVVLVGADLIAAESLRLFN---KEDKPSEQVAARQLGK---DIAGRRAIVPPFMPGKRMVITMLPNLQ 288 Edwardsiella...
WP_012987559    208 TCIPQQFIHDPRLVVLVGADLVAAEQYRLYQ---SADRPTEKIAAQMLGS---SIAGRPAMVPPFMPGKRMVVTMLPNLQ 281 Xenorhabdus ...
IEC:ABF-0018455 223 AKIPQQYRNDPRLVVLVGADLVAAEQYRLFQ---KADRPTEKIAAQMLDS---TIAGRPAIVPPFMPGKRMTVTTLSNLH 296 Dickeya dada...
jgi:Ddes_0241   212 EGIPYYLQK--DLVALIGRDLIVRERAMLFEavqGTPTEKAAMD-----SfSQKYGGLPWETPSFFPARGLVITPLANLS 284 Desulfovibri...
WP_013513408    214 QGIPRYLRK--GLITLVGDELISHEHAGLYKaigNTPSEK-VLATQSLSL----LGGLPWMTPSNFPGRGLVITPLKNLS 286 Pseudodesulf...
Q15Y13          214 SMIPEEHADSGDLVAIVGRDLITRDKGRRYAqhgELPSEKQRIEMAQTID---TYGGLNAFTVPHFPARGVLVTSMSNLS 290 Pseudoaltero...
WP_013831780    311 IYWQEETRRRQIRDEPALDQIENYESVNEDYVVEDYGRTALVENV 355 Novosphingobium sp. PP1Y
P51720          284 VYTEAESVRRSLRNDEDKKGLVTSYYRQEGYVVEDLGLMTAIDHT 328 Haemophilus phage HP1c1
WP_014205476    284 ILTQEGTQWRRQQNNEDKLRFENNHIRMEGYAVGNMKKFAAIENV 328 Vibrio furnissii
WP_014292208    291 LYTQRGTRQRSAAHNQDRKGFESQYWRMEGYAVGEYRAYASFDes 335 Oceanimonas sp. GK1
ACR69431        289 ILTLKGSRRRKAEDAGERKQFENSYWRYEGYALGDPDLYAAVDEs 333 Edwardsiella ictaluri 93-146
WP_012987559    282 ILTQRNTRQRKAEFVDDRKQFENKYLRNEGYALETPELYAAYDes 326 Xenorhabdus bovienii
IEC:ABF-0018455 297 IYTQRNTRQRKAEFVEDRKQFENKYLRNEGYAVEYPELYASFdes 341 Dickeya dadantii 3937
jgi:Ddes_0241   285 LYHQDTSWRRKIEDNAKKDQYEDYLSRNEGYVVETPEQLvawefa 329 Desulfovibrio desulfuricans ATCC 27774
WP_013513408    287 IYVQEESWRRKVEDNPKKDRIEDYNSRNEGYVVEVPEQlvgvefd 331 Pseudodesulfovibrio aespoeensis
Q15Y13          291 LYYQESSIRRQIVDEPKKNQYADYRSQNEGYVVETLEKAAYIEGA 335 Pseudoalteromonas atlantica T6c
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap