Conserved Protein Domain Family
SpdB

?
pfam05122: SpdB 
Mobile element transfer protein
This proteins are involved in transferring a group of integrating conjugative DNA elements, such as pSAM2 from Streptomyces ambofaciens. Their precise role is not known.
Statistics
?
PSSM-Id: 398681
Aligned: 3 rows
Threshold Bit Score: 73.0993
Threshold Setting Gi: 502765726
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9ADC5       12 RIGPVQIGTHRDRhGQTKHAAVCSNDGCGWSADYTSQSAAQLAARTHRC 60  Streptomyces coelicolor
WP_013000710 10 RIGPVNVASYIER-GKHRHLAACTAPRCDFSAEYDSRAAAELAARTHRC 57  Streptomyces scabiei
WP_023550060 11 SIGPVQVGSYNNGrGQIRHAAACTAPKCGFSTDHGDRSAAELAARTHRG 59  Streptomyces roseochromogenus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap