3BWW


Conserved Protein Domain Family
DUF692

?
pfam05114: DUF692 
Protein of unknown function (DUF692)
This family consists of several uncharacterized bacterial proteins.
Statistics
?
PSSM-Id: 398674
Aligned: 184 rows
Threshold Bit Score: 226.519
Threshold Setting Gi: 212561403
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3BWW_A          5 GAGLGYRRDLAEGFLq--------LRnnDR---IQFXEIAPENWIKXGGFARYQFDKV--AEKIPILIHGLSLSLGGQAP 71 
Q65P15          6 GVGLSFRQNFFKDL----------DV--IKq-dVDFLEIISERYF--DKKNEEELNTI--RNYFPLIPHGLSLSIGTYEP 68  Bacillus liche...
MA:Aflv_2099   32 KIGICYRDSIHEEFI---------DK--LIe-yVDFLELMPD---ITGYKETKRLLKIckDKNIDIGIHCLKSSLGSKEG 96  Anoxybacillus ...
WP_004870276   10 ALGLGLRRSFLAELA---------AR--DPl-pVDFLETSPENWFRFGGRPAHTLRQL--SERVPLLAHGLSLSIGGPDP 75  Acidithiobacil...
jgi:Mmol_1966   9 GAGLGLKRELIPQIQsh-----hnQT--LIs-nIQFVEIAPENWIDAGSKASKQLDWF--AARYPIVCHGLCLSLGGISP 78  Methylotenera ...
jgi:M301_2385  11 GVGLGLKRELIPQIQaa-----ygDN--IIa-nLNFVEIAPENWIEIGGKAAKQLDWF--AKRYPIVCHGLCLSLGGLAP 80  Methylotenera ...
CAL95470        8 GAGLGFRRELMQELE---------RE--VPa-pISFFEIAPENWASSGGRHARQLRIW--TERHPFVCHGLSLSLGGTMP 73  Azoarcus sp. BH72
Q47B98          8 GAGLGFRRELIAALK---------AG--VPe-aIRFFEIAPENWAGMGGRSTKDLRQF--TERYPFVCHGLSLSLGGPGP 73  Dechloromonas ...
Q5QWR8          5 SVGLGLRNELLDAAL---------AG--DId--ADFLEIAPENWIPFKGSRLEKLAQI--AGKYQLTCHGLSLSIGSQDS 69  Idiomarina loi...
WP_012238681    8 GVGLGLRWEFLDEVLaaldapdhgAR--DAalpVPFFELSPENYMRRGGYFPAAIERV--REHRPILTHGLTLSVGGLDP 83  Sorangium cell...
3BWW_A         72 LDKELLSSIKAXIKQYNTPFFSDHLSFC-ECDg-----HLYDLLPXPFTDEAVKHTAARIREVQDFLEIQISVENTSYYL 145
Q65P15         69 LSKKKEKQISNLLAELQINSYTDHLAMSsVKDi-----ELLDFFPVMYKEETFEFLINKYDQLKKGRLKNLYLENITYTF 143 Bacillus liche...
MA:Aflv_2099   97 IYRPAIEQYAFYSEYVEAAYYSDHVAYShMHDv-----YLSKVFPVEYDMENILIMRRNLEIVSSFFSNQILLENITQNK 171 Anoxybacillus ...
WP_004870276   76 LDRALLDDVARFLEEHGCPHYSEHLAFC-RDGs-----YLHDLLPIPFNEDTLRHCRDRIVQVQDILERPLLLENTAYYG 149 Acidithiobacil...
jgi:Mmol_1966  79 LNTDFLQLVKQFLNRYNIDIYTEHLSYC-TDAyqgkqgYLYDLLPIPFTEEAVHYVAQRIRQTQDLLGRRIGIENASYYA 157 Methylotenera ...
jgi:M301_2385  81 LDTNFLNQVKQFLQQYQIPLYTEHLSYS-TDGykgqqgYLYDLLPIPFTEEAVHYVAKRIRQTQDILGQRIAIENASFYV 159 Methylotenera ...
CAL95470       74 LDTDLLREIRRFMAMHGIRLYTEHLAWT-GDDg-----HLYDLLPLPCTGEAVRWTAGRIRQAQDVLGMRIGIENASCYL 147 Azoarcus sp. BH72
Q47B98         74 LDESLLRRIKAFMTEHGMTLYTEHLSWC-ADDs-----HLYDLLPIPLTEKAVEWTADRIKRAQDILGMRIGIENASYYL 147 Dechloromonas ...
Q5QWR8         70 LSQSFLKDVKRFLNDFDIEIYSEHLSYC-SHNg-----QLYDLLPIPFTVDAVAYVAERIKQAQDRLGQALILENVSYY- 142 Idiomarina loi...
WP_012238681   84 LDAGYLRALGGFLERLDPPFHSDHLCFSgVDGa-----FLHDLLPLPHTSAAAAHAAARIREAEQRLERPMAIENITYYL 158 Sorangium cell...
3BWW_A        146 HSETSTXNEVEFLNAIVQEANC--GIHLDVNNIYVNAVNHGl-------LDP----HVFIDNVDLKRVNYIHIAGHDD-E 211
Q65P15        144 NWHNNDFSELDFWYKLLNETNI--GMLLDVSNLYINSINHK--------YDP----YAFFDKLPKDKINYLHVAGFirnK 209 Bacillus liche...
MA:Aflv_2099  172 LSNKGQLNEGRFFRELLKNANSriKILFDVTNAYVTALNNN--------YAF----EEYVSEYPFEKIECIHVSGFERdN 239 Anoxybacillus ...
WP_004870276  150 DFANSTLSETEFFCQLVHESDC--RILLDINNLYVNSRNHG--------YDA----LSFLRALPAERVVYLHLAGHaah- 214 Acidithiobacil...
jgi:Mmol_1966 158 AAPISEMSELTFLNAVLSEADC--MLHLDINNIYVNSINFN--------FDP----LAFLRGIPQERIIYSHIAGHyqq- 222 Methylotenera ...
jgi:M301_2385 160 QAPISSMDELTFIKAVLIEADC--LLHLDINNIYVNSVNFGhvlsdglkADPikiaQEFLRGIPGERIVYAHMAGHyqq- 236 Methylotenera ...
CAL95470      148 APPGAEMDEADFIRAVVEEADC--LLHLDVNNVHVNACNLG--------FDA----HDFLRRLPLERVCYIHVAGHhie- 212 Azoarcus sp. BH72
Q47B98        148 SPPGAEMTEAEFINAIVREADC--LLHLDVNNIYVNSRNFG--------FDP----LAFMASLPLERTCYVHVAGHyve- 212 Dechloromonas ...
Q5QWR8        143 ASPSPELTELEFINQVLEAGDC--KLLLDVNNVFVNSVNHS--------YDP----YEFIDGLPSERIVYGHIAGHhee- 207 Idiomarina loi...
WP_012238681  159 VPGRASLDEADFLVEVLERAGC--RLLLDVNNVYVNARNHG--------FDP----VAFLEKIPPERVAAMHVAGHewrd 224 Sorangium cell...
3BWW_A        212 HaatevqiqtsesfnkikgdlrhlpPLLVDTHGENVKGTVWDLLEYTYARLSHxP-PTLLERDFNFPPFEKLCKEVDIIH 290
Q65P15        210 Y------------------------GFLIDSHSEPVHKEVWKLAEYIIKKA-P-VkGVILERDLNYQNYHDVKNDIKIIK 263 Bacillus liche...
MA:Aflv_2099  240 E------------------------GVLRDTHSNSLNEEILISTEWILQRTNP-K-YILVERDFNVQCIDDVLEDIYKLR 293 Anoxybacillus ...
WP_004870276  215 -----------------------psgQLIDTHDRGVSAPVLQLLREALAYLGP-R-PILLEWDHAIPRLDLLLEELGQLA 269 Acidithiobacil...
jgi:Mmol_1966 223 -----------------------spdLLIDTHGEDVIDPVWALLKDAYDLFGV-F-PTLLERDNNIPALDTLMQEVDKIA 277 Methylotenera ...
jgi:M301_2385 237 -----------------------apdLLIDTHGADVIDPVWALLEEAYQLFGA-F-PTCLERDNNIPPLSVLMREVNKIA 291 Methylotenera ...
CAL95470      213 -----------------------pdgLVIDTHGAAVIDPVWGLLEAAYRHTGP-V-PTCLERDFNFPPLSDLAAEVGRIA 267 Azoarcus sp. BH72
Q47B98        213 -----------------------pdgLLIDTHGAEVIDPVWSLLEAAYTRIGG-TvPTCLERDFNIPDLSALTAEVEQIT 268 Dechloromonas ...
Q5QWR8        208 -----------------------yedLYIDTHGASVKDEVFQLLDYAYGRHGV-Y-PTLLERDFNFPSLEELNQELNRIK 262 Idiomarina loi...
WP_012238681  225 -----------------------daeVLVDTHGAPAIAPVLDLLARAVARTGP-V-PVVLERDNDVPPLGALLAELAEVD 279 Sorangium cell...
3BWW_A        291 QLQQ 294
Q65P15        264 SLVY 267 Bacillus licheniformis DSM 13 = ATCC 14580
MA:Aflv_2099  294 RIVH 297 Anoxybacillus flavithermus WK1
WP_004870276  270 ATat 273 Acidithiobacillus caldus
jgi:Mmol_1966 278 DLQR 281 Methylotenera mobilis JLW8
jgi:M301_2385 292 DFQQ 295 Methylotenera versatilis 301
CAL95470      268 ALQA 271 Azoarcus sp. BH72
Q47B98        269 RFQA 272 Dechloromonas aromatica RCB
Q5QWR8        263 AIQA 266 Idiomarina loihiensis
WP_012238681  280 AAYR 283 Sorangium cellulosum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap