Conserved Protein Domain Family
Amelin

?
pfam05111: Amelin 
Ameloblastin precursor (Amelin)
This family consists of several mammalian Ameloblastin precursor (Amelin) proteins. Matrix proteins of tooth enamel consist mainly of amelogenin but also of non-amelogenin proteins, which, although their volumetric percentage is low, have an important role in enamel mineralisation. One of the non-amelogenin proteins is ameloblastin, also known as amelin and sheathlin. Ameloblastin (AMBN) is one of the enamel sheath proteins which is though to have a role in determining the prismatic structure of growing enamel crystals.
Statistics
?
PSSM-Id: 398673
Aligned: 11 rows
Threshold Bit Score: 413.838
Threshold Setting Gi: 512815377
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_018880683   5 KIPLFKMKDLILILCLLEMSFAVPFFPQQSG----T-PGMASLSLETMRQLGSLQRLNT-----------LSQYSRYGFG 68  western lowland...
XP_008265993   5 KIPLFKMKDLILLLCLLETSFAVPAFPQQPG----T-PGMASLSLETMRQLGSLQGLNA-----------LSQYSKYGFG 68  rabbit
XP_005333329   5 KISFFKMKDLILILCLLEMSFAVPMFPQQPGapgmA-PGMASLSLETMRQLGSLQGLNA-----------LSQFSRFGFG 72  thirteen-lined ...
Q62840         5 KIPLFKMKGLLLFLSLVKMSLAVPAFPQQPGaqgmApPGMASLSLETMRQLGSLQGLNA-----------LSQYSRLGFG 73  Norway rat
Q811C6         5 KIPLFKMKDLMLFLSLLKISFAVPAFPQQPGapnmApPGMASLSLETMRQLGSLQGLNA-----------LSQYSRFGFG 73  domestic guinea...
XP_007667390  41 tgPTLKMENLVLILSLFGTSFAIPVF-LQPG----GpPGMGSLSLETMRHLGN---LNL-----------LPQFSRFGFG 101 platypus
XP_004009935   5 KIPLFKMKDVILILCLLKMSSAVPAFPQQPG----I-PGMASLSLETMRQLGSLQGLNL-----------LSQYSRFGFG 68  sheep
XP_001489030   5 kiplfkMKDLVLILCLLEMGSAVPAFPRQPG----I-PGMASLSLET-----------MrqlgslqglnmLSQYSRFGYG 68  horse
XP_539304      5 KIPLFKMKDLVLILCLLKMSSAVPVFPQQPG----T-PGMASLSLETMRQLGSLQGLNM-----------LSQYSRFGFG 68  dog
XP_002938667   1 ------MEPLVLVLCLLSTAMAYPMHPQAPG----T-QGLASISLETMRQQQAANTLTAp----------FSQISRFGYN 59  tropical clawed...
XP_012667598   2 tISLFKMKGLLLTLWFLHVSAAVPVFPQQSG----V-PGMASLSLETMRQLGSLQGLNT-----------LSQYSRFGFG 65  small-eared galago
XP_018880683  69 KSFNSLWMHGLLPPHSSLPWM--RPREHETQQYEYSLPVHPPPLP-SQPSLKPQQPGLKP---FLQSAAATT-NQA-TAL 140 western lowland...
XP_008265993  69 KSLNSLWLQGLLPPPSSFPWM--RPREHETQQYEYSLPVHPPPLP-SQPSLQPQQPGLKP---FLQPTAAPA-IQG-TAQ 140 rabbit
XP_005333329  73 KSLNSLWLHGLLPPHSSLPWL--RPTEHETQQYEYSLPVHPPPLP-SQPSLQPQQSGLKP---FLQPTAATA-IQA-TAQ 144 thirteen-lined ...
Q62840        74 KALNSLWLHGLLPPHNSFPWI--GPREHETQQYEYSLPVHPPPLP-SQPSLQPHQPGLKP---FLQPTAATG-VQV-TPQ 145 Norway rat
Q811C6        74 KSLNSLWLQGLLPPPSSFPWL--RPREHETQQYEYSVPVHPPPLP-SQPSQQPPQPGMKH---FQQPTATPA-IQD-TPQ 145 domestic guinea...
XP_007667390 102 KQFNSLWMHGFLPPHSNYPWL--SPRDQETQQYEYALPVHPPPRP-SQRTLQPQQPKQNA---FLPPTVAPS-AQGpPAQ 174 platypus
XP_004009935  69 KSFNSLWMNGLLPPHSSLPWM--RPREHETQQYEYSLPVHPPPLP-SQPSLQPQQPGQKP---FLQPTVVTS-MQN-AVQ 140 sheep
XP_001489030  69 KSFNSLWMNGLLPPPSSFPWM--RPREHETQQYEYSLPVHPPPLP-SQPSLQPQQPGQKA---FLQPTIVTSgIQD-TIQ 141 horse
XP_539304     69 KSFNSLWMHGLLPPHSSFPWM--RPREHETQQYEYSLPVHPPPLP-SQPSLQPQQPGQKP---FLQSAIVTD-IQD-TAQ 140 dog
XP_002938667  60 DPYSVLWLHGLLPPHSSYPWLhqRPQLSDNQQFEYALPIHPPPLPgAQSPAQTEKPGQHAqnmPQQPQAAAStDQV---- 135 tropical clawed...
XP_012667598  66 KSFNSLWLQGLLPPQPSLPWM--RPREHETQQYEYSLPVHPPPLP-SQPALQPQQAGLKP---FLQPTAATA-VQG-TAQ 137 small-eared galago
XP_018880683 141 KEALQPPIHLGQLPLQEGELPLVQQ-QVAPSDKPPKPEL--PGVDFADPQGPSlpgmdfpdpqgpslpgldfahpqgstI 217 western lowland...
XP_008265993 141 KGGPQLRIHPAQLPLKDGEMPEIQE-QVAPTEKPPKPEL--PAMDFAGPQVPT--------------------------V 191 rabbit
XP_005333329 145 KGGPQPPMHPRQLPLQDGEPPATEQ-QVAPTEKPPTSKL--LVMDFAGPQVPS--------------------------L 195 thirteen-lined ...
Q62840       146 KPGPHPPMHPGQLPLQEGELIAPDEpQVAPSENPPTPEV--PIMDFADPQFPT--------------------------V 197 Norway rat
Q811C6       146 KAGPQPPMHPRQLPLKDAELPEAHE-QVAPTEMPLNPEL--PVLDFADPQIPS--------------------------V 196 domestic guinea...
XP_007667390 175 NGDPQPPILHLQPPLQQEEKPSVQE-QVAPPKRPPKPEL--PALDFTVQLRQS--------------------------I 225 platypus
XP_004009935 141 KGVPQPPIYQGHPPLQQAEGPMVEQ-QVAPSEKPPTTEL--PGMDFADLQDPP--------------------------M 191 sheep
XP_001489030 142 KGGHQPPVYQRQPPLQQSEGPMVQQ-QVAPSDKPPKAELreMDFPGpqd----------------------------pqM 192 horse
XP_539304    141 KRGTQPPVYQGQPPLQQTEGPMLEQ-QVAPSDKPPKAEL--PGMDFAEPQGPSv-------------------------- 191 dog
XP_002938667 136 --SHQPSLPLGFPILQ----------QADPAMMPPKGG-------PADGQIQTva----------------------lyM 174 tropical clawed...
XP_012667598 138 KGRPQPPVHLGQLPLQEGELPAVQE-QVAPEEKLPKPEL--PIMDFAGPQGPS--------------------------I 188 small-eared galago
XP_018880683 218 FQ-IA-RLISHGPMPQN---------KQSPLYPGMLYVPFGANQL----NAP-ARLGIMSSEEVAGGR-EDPMAYGAMFP 280 western lowland...
XP_008265993 192 FQ-IA-RLIPRGPLPQN---------RHAALYPGMFYMSYGGNQL----NAP-ARLGILSSEEMPGER-GGPMAYGAMFP 254 rabbit
XP_005333329 196 FH-IA-RVISRGPLPQN---------KPSALYPGMFYTSYGANQL----NAP-TRLGMMSSEEVDGGR-GGPMGYGAMFP 258 thirteen-lined ...
Q62840       198 FQ-IA-HSLSRGPMAHN---------KVPTFYPGMFYMSYGANQL----NAP-ARIGFMSSEEMPGER-GSPMAYGTLFP 260 Norway rat
Q811C6       197 FQ-IA-RFVSRVPVPQN---------KPAMLYPGMVYMSYGTNQL----SAPaARLGFMSSEEMPGGR-VAPVTYGGLLP 260 domestic guinea...
XP_007667390 226 FP-IAqKLISQGPRQKA---------EQSPLYPELVYVPFGANQQ----NAApARLGKVSSEEMPGGG-GEPLAYGSIFP 290 platypus
XP_004009935 192 FP-IA-HLISRGPMPQN---------KPSPLYPGIFYVTYGANQL----NAP-ARLGIMSSEEMGGGR-GGPVAYGAIFP 254 sheep
XP_001489030 193 FP-IA-RLIARGPMPPN---------KQAPLYPGLFYLTYGANQLntpgRLG-I----MSSEEMAGGR-GGPMAYGAMFP 255 horse
XP_539304    192 FQ-IA-RLISRGPMPQN---------KPSPLYPGIFYMSYGANQL----NAP-GRLGIMSSEEMAGGR-GSPMAYGAMFP 254 dog
XP_002938667 175 YQtIMnKLLQQGagetipdpagtlpvnqqhpYPGLFFMQYGGGPG----GPP-ARLGAMSSEEITGGRtGAAHAFSSLYP 249 tropical clawed...
XP_012667598 189 FQ-IA-RLIARGPMPQN---------KQSPLYPGMFYVSYGANQL----NAP-GRLGIMSSEEMAGGR-GGPMGYEAVFP 251 small-eared galago
XP_018880683 281 GFGGMRPGFEGMPHNPAMGGDFTLEFDSPVAATK--------GP---ENEEGGAQGSPMPEANPDNPENPAFLTELEPAP 349 western lowland...
XP_008265993 255 RFGGIRHSLGGMPHNPAMGGDFTLEFDSPVAATK--------GP---EKGEGAAEDAPMPEANPSNPENPALLQEVAHGA 323 rabbit
XP_005333329 259 GFGGLRHSLRRMSPNPAMGGDFTLEFDSP-AGTK--------GP---EKGEGEAQASPMQEANPANPKNPALLSQIAPGA 326 thirteen-lined ...
Q62840       261 GYGGFRQTLRGLNQNSPKGGDFTVEVDSPVSVTK--------GP---EKGEG-PEGSPLQEASPDKGENPALLSQMAPGA 328 Norway rat
Q811C6       261 GLTGVRHTIRRVPQDPTMAGDFTLEFDTP-AATK--------GP---EKGEGGAQGSPLHETKGEDPENAALLSQIAPGA 328 domestic guinea...
XP_007667390 291 GFGSMRPGFGAMQINPALGKDFTLEDDSPTVAGK--------PP---GQG-GEVLGSPRDGAIPAGHPNPGLLPERISRL 358 platypus
XP_004009935 255 GFGGMRPSLGGMPQNPDMAGDFTLEFDSPVAATK--------GP---EKGEGGAQDSPVPEAHLADPESPALLSELAPGA 323 sheep
XP_001489030 256 GFGGMRSSLRGMPPNPAMGGDFTLEFDSPVAATK--------GP---EKGEGGPQGSPAKEADEANPENQALLSEIASGP 324 horse
XP_539304    255 GFGGMRPNLGGMPHNPGMGGDFTLEFDSPVAGTK--------GP---EKGEGGAQGSPMPDVNPANPENPALLTELAPGA 323 dog
XP_002938667 250 GLLGMGPRLESHPQNPALQGDFTIEDDSPVAGQKptgqevsqGPiesPQGVGSSIMIPGLEGSPTG-------------- 315 tropical clawed...
XP_012667598 252 GFGGLRPSLGGLPHNPAMGGDFTLEFDSPLAATK--------GP---EKGEGGAPDTPGPEASPAHPEQPALPPELAPGA 320 small-eared galago
XP_018880683 350 HAG-LLALPKDDIPGLPRSPSGKMKGLP-SVTPAAADPLMTPELADVYRTYDADMTTSVDFQEEATM--DTTMAPNSLQT 425 western lowland...
XP_008265993 324 HAG-LLAFPKDNIPGMARGPAGKKMGVP-RVTPSDADPLATPELAEVYDIYGPDVTTPLGTQEETTT--DTTMTPDTQET 399 rabbit
XP_005333329 327 HAG-LLAFPNDNIPNLARGPARQKKGPL-GVTPSAADPLMTPELAEVYETYGDDVTTPLDT-GEATM--DTTMTPDTQQT 401 thirteen-lined ...
Q62840       329 HAG-LLAFPNDHIPNMARGPAGQR--LL-GVTPAAADPLITPELAEVYETYGADVTTPLGD-GEATM--DITMSPDTQQP 401 Norway rat
Q811C6       329 HTG-LFGFPNDNVPSMARGPSGHRNRPL-EVTPVTADPLITPELAEIYETYGGDVTTPLG---EATM--ETTMTPDTPQT 401 domestic guinea...
XP_007667390 359 RSGaALTFPSDFIPHRGQGPAGQSKLPP-GVTPPPADPLMTPGPSDPLEFFEGDGTTPLGLQREALL--DTTMTPDTQST 435 platypus
XP_004009935 324 LGG-LLANPEGNIPNLARGPAGRSRGFLrGVTPAAADPLMTPGLAEVYETYGADETTTLGLQEETTM--DSTATPDTQHP 400 sheep
XP_001489030 325 LGG-LLALPKGSVPNLARGPAGQSRGPP-RVTPAAADPLMTPGLAEAYETYGADVTTPLDFEEETTT--DTTVTPESPQT 400 horse
XP_539304    324 LGG-LLAHPKDNDPSLARGPAGQSGGPP-RVTPADADPLMTPELADIYETYGADVTTPL---EETPT--DTTVIPDTQQT 396 dog
XP_002938667 316 -QGeTVPFPNINSPNMGFNP--QSKIPP-GVTPANA-PRLTHDTGAGYVPFALDDTMPFGIQRENVIsgDITRANNAKGI 390 tropical clawed...
XP_012667598 321 HPG-LLAFPDDEDPSLARGPAGQRLGPP-GVTPAAADPLMTPELADIYGTYAADVTTPL----EATT--DTTGAPDLLET 392 small-eared galago
XP_018880683 426 -SMPGNKAQEPEMMHDAWHFQEP 447 western lowland gorilla
XP_008265993 400 -SIPGNKDQHSQMMHNAWRFQEP 421 rabbit
XP_005333329 402 -SMPGNKVHQPQMVHDAWRFHEP 423 thirteen-lined ground squirrel
Q62840       402 -PMPGNKVHQPQ-VHNAWRFQEP 422 Norway rat
Q811C6       402 -PMPGNKVRQPQMVHEPWHFQEP 423 domestic guinea pig
XP_007667390 436 -YMPGNEAQQMQVTQDQWQFQEP 457 platypus
XP_004009935 401 -LMPRNKAQQPQIKHDAWHFQEP 422 sheep
XP_001489030 401 -SMPGNEAEQPQMVHDAWRFQEP 422 horse
XP_539304    397 -LMPENKAQQPQIMHDGWHFQEP 418 dog
XP_002938667 391 -ESPIMQHEVHLQNHNNY-FQEP 411 tropical clawed frog
XP_012667598 393 sSAPGNRAQQAQAAREVWRYQEP 415 small-eared galago
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap