3NOK


Conserved Protein Domain Family
Glu_cyclase_2

?
pfam05096: Glu_cyclase_2 
Glutamine cyclotransferase
This family of enzymes EC:2.3.2.5 catalyze the cyclization of free L-glutamine and N-terminal glutaminyl residues in proteins to pyroglutamate (5-oxoproline) and pyroglutamyl residues respectively. This family includes plant and bacterial enzymes and seems unrelated to the mammalian enzymes.
Statistics
?
PSSM-Id: 398663
Aligned: 39 rows
Threshold Bit Score: 307.2
Threshold Setting Gi: 503363239
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3NOK_A          22 SPTNRPVPDaggs----vqePVRrvahIIREYPHATNAFTQGLVFH-QGHFFESTG--HQG--TL-RQLSL------ESA 85 
WP_022545460    20 AIGINCQNPtfaqsvkaqryVCR----VVESFPHDVNSYTQGLFFH-NGQLYESAG--QYGksSF-RKVDI------KKG 85  Bacteroidales...
WP_013307260    99 TTAEISKKIkvlaptapalyTYE----IINEYPHDIKAYTQGLEFH-DGILYESTG--KKGrsSL-RKVDY------NTG 164 Maribacter sp...
WP_013597900    97 LTATREFNIlvfadhpaqewQYN----LVNTYPHNPADFTQGFYYK-DGFIFEGTG--LTGqsRL-VKYRLgstteeLTG 168 Weeksella
tigr:CJA_2408   18 IAMSPGSGAap-------tiPYK----IITERTHKPTLFTQGLQIE-NDQFYESSG--LYGksLL-VSYPV------EEP 76  Cellvibrio ja...
WP_015234192    23 GSALVACAAqdlr---apvySVR----VVNTFPHDPNAFTQGLIFE-DGVLYEGTG--LEGqsEL-RKVDL------KTG 85  Deinococcus p...
Q5VRH1          73 WLANAAPAAllrrpvsttfySFD----LLREYPHDPYAFTQGLLYGgNDTFFESTG--LYHrsSV-RRVDL------KTG 139 Japanese rice
NP_001305615    35 FSEAEASYGa---------yKVK----VINEFPHDPEAYTQGLLYAeNDTLFESTG--LYGrsSV-RKVAL------QNG 92  potato
XP_003533156    52 LSSNKLRAFqrgv----syeTIT----VVNVFPHDPQAFTQGLVYDrNDTLFESTG--LYGksSV-RKVAL------HTG 114 soybean
jgi:Niako_2739  17 CGSSEEKEEekttapvtpaiKYE----EVDYFMHDTSLFTEGLLIH-DGQLFESTGspEKGrkSLiGINDL------KTG 85  Niastella kor...
3NOK_A          86 Q----------PVWMERL-GNI-FAEGLASDGERLYQLTWTEGLLFTWSGMPPQRERTTRY--S-GEGWGLCYWNGKLVR 150
WP_022545460    86 T----------ALQSFSFpDKY-FAEGSVVLDNNLYILTWMERVVFVYDINTLKPVKQFFN--PfAEGWGLTTDGKQLIM 152 Bacteroidales...
WP_013307260   165 K----------VLAQIDLeNTQ-FGEGITIMNGKIYQLTWQNGIGFIYDLTDFKKIDSFQYg-QsKEGWGLCHDGEKIFK 232 Maribacter sp...
WP_013597900   169 E----------VEKTS-------FGEGITELNGVIYQLTWQNRLIYEYD-QNFELIRKITMpgEiREGWGITTMGQELVI 230 Weeksella
tigr:CJA_2408   77 EgstwarlsapFTHKQPLpERF-FAEGLTLLDDKLYLLTWKEGTLLVYDKTTLHYQKSLGY--T-GEGWGLTTDGEYLIR 152 Cellvibrio ja...
WP_015234192    86 K----------VLQRLALpTNV-FGEGLTSFAGQLVQLTWTTGVGYVYDKASFRRIRTFNY--A-TEGWGLTHDGKSLIL 151 Deinococcus p...
Q5VRH1         140 K----------VLVQHEMdGRL-FGEGLTLLNDKLFQVVWMKNQGFIYDRHNFSKRESFTH--KmSDGWGLATDGKVLFG 206 Japanese rice
NP_001305615    93 K----------VETVHEMqASD-FGEGLTLLGESLFQLTWLQDTGFIYDRYNFSKFKKFTH--HmQDGWGLATDGKVLFG 159 potato
XP_003533156   115 K----------VEDVQKMdSSL-FGEGLTLLNNRLFQVTWLQKAGFIYNPKNLRKIGTFNH--AmKDGWGLATDGKVLFG 181 soybean
jgi:Niako_2739  86 N----------FIKKVELgQDSlFGEGIVFFKNKLYQLTYKNHIGFIYDANSYKKIGQFPI--K-KEGWGLTTDGKAIVM 152 Niastella kor...
3NOK_A         151 SDGGTMLTFHEPDGFALVGAVQVKLRGQPVELINELECANGVIYANIWHSSDVLEIDPATGTVVGVIDASALTRAVAGqv 230
WP_022545460   153 SDGSSNLYFMDPQTFAEKGRIKVKLNGKELNQLNELEYIKGEIWANVYQEDYIVIINPKTGAVRAMADCKNLLPGSMR-- 230 Bacteroidales...
WP_013307260   233 SDGTEKIWFLNPDTLAEEGFIQTVTNKSVFNMANELEYIDGKIYANVYQKPSMMIIDALSGAIEGVINFGGLKEKVTK-- 310 Maribacter sp...
WP_013597900   231 TDGSQKIHFFD-KDFNYKRTIQAVDDKQAYSNLNELEYHNGLLYINIYQQNIIVAVDPASGAVVGKMNLEAFKAEQAA-- 307 Weeksella
tigr:CJA_2408  153 SDGSDTLFFHAPQDFRLEKTMKVQDQGKAITRINELEYHAGFIWANIWHEDRIIRIDPNTGDATGELVLSALRNTMKL-- 230 Cellvibrio ja...
WP_015234192   152 SDGSSRLYFLDPSTYRVQRTVNVTADGQNVVRLNELEFVGGQVLANVWLTNRIARIDPKSGKVSAWYDLTDIVNRVPD-- 229 Deinococcus p...
Q5VRH1         207 SDGTSRLYQLDPKSIQVMKTVTVKYQDNEVPYLNELEYINGEVWANVWQTDCIARVSHEDGLVVGWIFLHELRQHLWN-- 284 Japanese rice
NP_001305615   160 SDGTSTLYKIDPKTMKVIRKQVVKSQGHEVRYLNELEYVKDEVWSNVYGTDCIARISPKDGTVIGWILLQSLREDLKS-- 237 potato
XP_003533156   182 SDGSSTLYQIDPQTFKALSKQVVHYKGHQVHNLNELEYINGEVWANVFMTDCIVRISPSDGNVLGWILLQNLRKELIK-- 259 soybean
jgi:Niako_2739 153 SDGTDTLNYLNPDDLTTYKKLPVTENGRRRDSLNELEYIKGYIYANIWLTNNIVKINPADGKVVGKLDLSTLALKAAL-- 230 Niastella kor...
3NOK_A         231 TNPE--AVLNGIAVEPGSGRIFMTGKLWPRLFEVRL 264
WP_022545460   231 TTKT--DVLNGIAYNPQNDQIYVTGKYWPKLFRISL 264 Bacteroidales bacterium CF
WP_013307260   311 HADL--DVLNGVAYHPERKTFFVTGKNWDKMFEVNI 344 Maribacter sp. HTCC2170
WP_013597900   308 DA----DVLNGIAF--KGENMLVTGKLWNKIYEVSI 337 Weeksella
tigr:CJA_2408  231 NNPE--QVLNGIAWDEKRNGFWITGKLWPKMFLIqp 264 Cellvibrio japonicus Ueda107
WP_015234192   230 RGPD--DVLNGIAYDAKGGRLFITGKRWPALYEVKL 263 Deinococcus peraridilitoris
Q5VRH1         285 SGNTeiDVLNGIAWDEENQRLFVTGKLWPKIYEIKL 320 Japanese rice
NP_001305615   238 RGYKyfEVLNGIAWDRDGDRIFVTGKLWPKIFEIKL 273 potato
XP_003533156   260 AGNNdiDVLNGIAWDGEQKRIFVTGKLWPKLYEIKV 295 soybean
jgi:Niako_2739 231 TTGG--DALNGIAWDSTTGYMYVTGKLWPHIHQLKL 264 Niastella koreensis GR20-10
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap