4XWH,2VC9


Conserved Protein Domain Family
NAGLU

?
pfam05089: NAGLU 
Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain
Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
Statistics
?
PSSM-Id: 398659
Aligned: 137 rows
Threshold Bit Score: 346.398
Threshold Setting Gi: 290571715
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4XWH_A       107 RYYQNVCTQSYSFVWWDWARWEREIDWMALNGINLALAWSGQEAIWQRVYLALGLTQAEINEFFTGPAFLAWGRMGNLHT 186 human
CCY34524     131 RYYLNYCTFSYSMAFWDWERWEKELDWMALHGINLCLAAVGSDALWLNVLRRLGYSESDAAEFIAGPAFQAWWLMNNLEG 210 Alistipes sp. C...
CDF21114      56 RYYLNYCTHSYTMAFWDWKRWEQEIDWMALHGINLPLCIVGTDVVWRNVLLRLGYSKDEANRFIAGPGFQAWWLMNNLEG 135 Prevotella sp. ...
CDB04643     117 RYYLNYCTLSYSMAFWDWKRWEQELDWMALHGINLCLDIVGTDVVWRNVLLQLGYTRAEIDKIIAGPAFQAWWLMNNMEG 196 Prevotella sp. ...
CCY16788     108 RYDLNYCTFSYTMPFWDWARWEEELDWMAMHGINLPLALVGTDVVWRNVLLRLGYTTDEVNAFIAGPAWQAWWLMNNLEG 187 Prevotella sp. ...
WP_013063406 112 RYDFNYCTFSYSMAFWDWKRWEKEIDWMALHGINMPLAIVGEECVWRNMLLKLGYTEKEVGEFIAGPAFLAWWEMNNLEG 191 Prevotella rumi...
WP_005846260 133 RYDFNYCTFSYSMVFWNWDRWQQEIDWMALHGVNMPLAIVGEEVVWRNMLLRLGYTRDEVNRFIAGPAFLAWWAMNNLEG 212 Prevotella dent...
CCZ09617     112 RYDLNYCTYSYSMAFWDWERWEKELDWMALHGINLPLALTGTETVWRNVLLQLGYSAEEIGKFIAGPGFLAWWHMNNLEG 191 Odoribacter sp....
CCZ81891     112 RYDFNYCTYSYSMAFWDWERWERELDWMAMHGINMALALTGMEVVWHNVLQQLGYTAEEIGQFIAGPGFLAWWHMNNLEG 191 Odoribacter lan...
Q89ZL8       131 RYYLNYCTYSYSMAFWDWERWEKEIDWMAMHGINMPLSITGMEVVWYNLLKRIGYTTEEINEFISGPAFMAWWQMNNLEG 210 Bacteroides the...
4XWH_A       187 WDGPLPPSWHIKQLYLQHRVLDQMRSFGMTPVLPAFAGHVPEAVTRVFPQvNVTKMgSWghfncsYSCSFLLAPEDPIFP 266 human
CCY34524     211 WGGPNPDSWYKRNIGLQNRILQRMRELGIEPVLPGYSGLLPHDAAERLGL-NVSDPgLWq----gYHRPAFLQPEDRNFQ 285 Alistipes sp. C...
CDF21114     136 WGGPNTDNWYAQRETLQKRILKRMREMDIMPVLPGYSGMVPHNARQRLGL-DVADPgTWn----aYPRPAFLLPTDKRFA 210 Prevotella sp. ...
CDB04643     197 WGGPNSDAWYDQREALQKKILKRMNELGINVCLPGYSGMVPHDARQRLGL-DVSDPgMWc----gYKRPAFLLPTDKRFT 271 Prevotella sp. ...
CCY16788     188 WGGPNTDNWYRRQEELQRRIVGRMRELDIEPVLPGYSGMVPSNAKAKLGL-DVTDPgTWn----aYQRPAFLSPTDPRFA 262 Prevotella sp. ...
WP_013063406 192 WGGPLPTSWYARQEKLQKQILARMKQLGMHPVLPGYCGMVPHDAKEKLGL-NVADAgLWn----gFQRPANLLPTDARFS 266 Prevotella rumi...
WP_005846260 213 WGGPLPDSWYRQQEALQKRILQRERELGMEPVLPGYCGMMPHDAKQKLGL-DVTPGgTWn----gYVRPANLSATDPRFD 287 Prevotella dent...
CCZ09617     192 WGGPNPENWYKQQVQLQQRILNRMREFGIEPVFPGYAGMVPHDVKEKLGL-NVTDPgKWc----gFTRPAFLQPEDPAFQ 266 Odoribacter sp....
CCZ81891     192 WGGPNPESWYERQMQLQHRILNRMREYGIEPVFPGYAGMLPHNASEKLGI-EVKDPgLWc----gYQRPAFLYPENPAFK 266 Odoribacter lan...
Q89ZL8       211 WGGPNPDSWYRQQEALQKKIIARMRELGIEPVFPGYAGMVPRNIGEKLGY-QIADPgKWc----gFPRPAFLSTEDEHFD 285 Bacteroides the...
4XWH_A       267 IIGSLFLRELIKEFGTDXIYGADTFNEMQppSSEPSYLAAATTAVYEAMTAVDTEAVWLLQGWLFqhqpqfwgpAQIRAV 346 human
CCY34524     286 TIAAIYYEEQEKLFGKARFYSMDPFHEGG--RTAGVNLDSAGTAINSAMQHHSPGAKWVVQAWGA---------NPRPAM 354 Alistipes sp. C...
CDF21114     211 EIADIYYKEMTRLYGKADFYSMDPFHEGG--RTAGVDLGAAGKAIMQAMKRHNPHATWVAQAWGN---------CPYPQM 279 Prevotella sp. ...
CDB04643     272 EIATLYYKEQQRLYGKARFYSMDPFHEGG--SVEGVDLRAAGEAIMREMKRVNPEAVWVVQAWQA---------CPHPEM 340 Prevotella sp. ...
CCY16788     263 DIAGLYYDELTRLYGRTRYYAMDPFHEGG--NTAGVDLRAAGRAIHAAMKRCNPNAAWVVQAWQA---------NPRREL 331 Prevotella sp. ...
WP_013063406 267 EIATLYYNELTKLFGKADYYSMDPFHESN--DDPNIDYAKAGQAMMQAMKRVNPKAVWVIQGWTE---------NPREAM 335 Prevotella rumi...
WP_005846260 288 EIADLYYREQTRLYGKSHYYSMDPFHETS--DDVYIDYAQAGRKLMAAMKRENPKANWVIQGWTE---------NPRPAM 356 Prevotella dent...
CCZ09617     267 RVAGLYYAEMEKLFGKARFYSMDPFHEGG--STEGVDLAAAGKSILEAMKRANSSAVWVIQAWQA---------NPRPQI 335 Odoribacter sp....
CCZ81891     267 RIAGLYYMEMEKRFGKAKFYGMDPFHEGG--NVQGIDLAAAAQSVLQAMKTANPEAVWVMQAWQA---------NPRHEM 335 Odoribacter lan...
Q89ZL8       286 SFAAMYYEELEKLYGKAKYYSMDPFHEGG--NTEGVDLAKAGTSIMSAMKKANPEAVWVMQAWQA---------NPREAM 354 Bacteroides the...
4XWH_A       347 LGAVPRGRLLVLDLFAESQP-------VYTRTASFQGQPFIWCMLHNFGGNHGLFGALEAVNGGPEAARLFP---NST-- 414 human
CCY34524     355 IRSIPRGDLLVLDLYSESRPqwgdpssSWYRPEGFDGHDWLYCMLLNFGGNVGLHGKMQHVIDEYYKADSsr--fSTT-- 430 Alistipes sp. C...
CDF21114     280 IEPLERGDLLVLDLFSESRPqwgdsasTWRRKNGFGGHNWIYCMLLNFGGNVGLHGKMQHVIDEYYKACQsp--fGQT-- 355 Prevotella sp. ...
CDB04643     341 ISHLRNGDMLVLDLFSESRPqwgdpesTWYRKNGFDGHDWTFCMLLNYGGNVGLFGKLQHVVDEFYKARSsr--fAPT-- 416 Prevotella sp. ...
CCY16788     332 IAAVPRGDLVVLDLFAESRPqwgdtasTWCRPDGFDGHDWIYCMLLNYGGNVGLHGKMDHVLDEFRKARAsr--fGAT-- 407 Prevotella sp. ...
WP_013063406 336 VDDMKTGDLLVLDLFSECRPmfg-ipsIWKREQGYKQHQWLFCLLENFGANVGLHGRMDQLLDNFYMLQSsk--fQAQss 412 Prevotella rumi...
WP_005846260 357 TDGLPAGSLTVLDLFSECRPmfg-apsIWKRAEGYGQHDWLFCMLENFGGNVGLHGRMDQLIGNFRLATSPQsplQQArr 435 Prevotella dent...
CCZ09617     336 LDAIEAGDMLVLDLSSENRPmwgdkesPWYRENGYGKHDWLYCMLLNFGGNVGMYGRMDRVIDGFYAARel---rKGT-- 410 Odoribacter sp....
CCZ81891     336 ITALQPGNVLILDLSSENRPmwgdkesVWYREKGFEGQDWLYCMLLNFGGNVGMYGRMDRVINGFYAAVQhp--nGAS-- 411 Odoribacter lan...
Q89ZL8       355 VSTLDSGDLLVLDLYSEKLPqwgdpesMWYREKGFGKHDWLYCMLLNFGGNVGLHGRMEQLVNGYYNACAhv--nGKT-- 430 Bacteroides the...
4XWH_A       415 -MVGTGMAPEGISQNEVVYSLMAELGWRK 442 human
CCY34524     431 -MIGVGLTMEGIENNPVMYELVSELPWRP 458 Alistipes sp. CAG:831
CDF21114     356 -LRGVGLTMEGAENNPVMYELLTELPWRP 383 Prevotella sp. CAG:617
CDB04643     417 -MRGVGLTMEGIENNPVMYELVCELPWST 444 Prevotella sp. CAG:520
CCY16788     408 -LRGVGMTMEGSENNPVMFELLCDLPWLA 435 Prevotella sp. CAG:755
WP_013063406 413 kLKGIGFTMEGSENNPVMFELMSELPWRP 441 Prevotella ruminicola
WP_005846260 436 hLRGIGFTMEGSENNPIMFELMSELPWRT 464 Prevotella dentalis
CCZ09617     411 -LCGVGITMEGIENNPVMYELLLELPWRP 438 Odoribacter sp. CAG:788
CCZ81891     412 -LRGVGKTMEGIENNPVMYELLLELPWRK 439 Odoribacter laneus CAG:561
Q89ZL8       431 -LRGVGATPEGIENNPVMFELLYELPWRE 458 Bacteroides thetaiotaomicron
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap