6OGY


Conserved Protein Domain Family
Rota_VP2

?
pfam05087: Rota_VP2 
Rotavirus VP2 protein
Rotavirus particles consist of three concentric proteinaceous capsid layers. The innermost capsid (core) is made of VP2. The genomic RNA and the two minor proteins VP1 and VP3 are encapsidated within this layer. The N-terminus of rotavirus VP2 is necessary for the encapsidation of VP1 and VP3.
Statistics
?
PSSM-Id: 398657
Aligned: 3 rows
Threshold Bit Score: 1601.19
Threshold Setting Gi: 81961972
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6OGY_C   1 MAYRKRgaRRETNLKQDDRMQEKEENKNVNtNSENKNatkpQLSEKVLSQKEE----VITDNQEEIKI----ADEVKKSN 72 
A2T3R5   1 MAYRKRgaRRETNLKQDERMQEKEDSKNIN-NDSPKS----QLSEKVLSKKEE----IITDNQEEVKI----SDEVKKSN 67  Simian rotavirus A/SA...
Q91E96   1 MISRNR--RRNNQQKNIEKEKQLETIINKE-VKENKD----SMKEDKLVVTEEsngdVTTAKEQSNNInlqkNDLVKEVM 73  Human rotavirus C/Bri...
6OGY_C  73 KEESKQLLEVLktkEEHQKEVQyEILQKTIPTFEPKESILKKLEDIKPEQVKKQTKLFRIFEPRQLPVYRANGEKELRNR 152
A2T3R5  68 KEESKQLLEVLktkEEHQKEVQyEILQKTIPTFEPKESILKKLEDIKPEQAKKQTKLFRIFEPKQLPIYRANGERELRNR 147 Simian rotavirus A/SA...
Q91E96  74 NIQNQTLNTVV---TENKVEIE-EIVKKYIPSYNTDSLIVKKLTEIQESSAKTYNTLFRLFTPVKSYLYDINGEKKLSTR 149 Human rotavirus C/Bri...
6OGY_C 153 WYWKLKRDTLPDGDYDVREYFLNLYDQVLTEMPDYLLLKDMAVENKNSRDAGKVVDSETAAICDAIFQDEETEGVVRRFI 232
A2T3R5 148 WYWKLKRDTLPDGDYDVREYFLNLYDQVLMEMPDYLLLKDMAVENKNSRDAGKVVDSETAAICDAIFQDEETEGAVRRFI 227 Simian rotavirus A/SA...
Q91E96 150 WYWKLLKDDLPAGDYSVRQFFLSLYLNVLEEMPDYIMLRDMAVDNPYSAEAGKIVDGKSKEILIELYQDQMTEGYIRRYM 229 Human rotavirus C/Bri...
6OGY_C 233 AEMRQRVQADRNVVNYPSILHPIDHAFNEYFLQHQLVEPLNNDIIFNYIPERIRNDVNYILNMDRNLPSTARYIRPNLLQ 312
A2T3R5 228 AEMRQRVQADRNVVNYPSILHPIDHAFNEYFLQHQLVEPLNNDIIFNYIPERIRNDVNYILNMDRNLPSTARYIRPNLLQ 307 Simian rotavirus A/SA...
Q91E96 230 SELRHKISGETNTAKYPAILHPVDNELNQYFLEHQLIQPLTTRNIAELIPTQLYHDPNYVFNIDAAFLTNSRFVPPYLTQ 309 Human rotavirus C/Bri...
6OGY_C 313 DRLNLHDNFESLWDTITTSNYILARSVVPDLKELVSTEAQIQKMSQDLQLEALTIQSETQFLTGINSQAANDCFKTLIAA 392
A2T3R5 308 DRLNLHDNFESLWDTITTSNYILARSVVPDLKELVSTEAQIQKMSQDLQLEALTIQSETQFLTGINSQAANDCFKTLIAA 387 Simian rotavirus A/SA...
Q91E96 310 DRIGLHDGFESIWDSKTHADYVSARRFIPDLTELVDAEKQIKEMAAHLQLEAITVQVESQFLAGISAAAANEAFKFIIGS 389 Human rotavirus C/Bri...
6OGY_C 393 MLSQRTMSLDFVTTNYMSLISGMWLLTVVPNDMFIRESLVACQLAIINTIIYPAFGMQRMHYRNGDPQTPFQIAEQQIQN 472
A2T3R5 388 MLSQRTMSLDFVTTNYMSLISGMWLLTVIPNDMFIRESLVACQLAIINTIVYPAFGMQRMHYRNGDPQTPFQIAEQQIQN 467 Simian rotavirus A/SA...
Q91E96 390 VLSTRTIAVEFITSNYMSLASCMYLMTIMPSEIFLRESLVAMQLAIINTLIYPALGLAQMHYQAGEVRTPFELAEMQVAN 469 Human rotavirus C/Bri...
6OGY_C 473 FQVANWLHFVNNNQFRQVVIDGVLNQVLNDNIRNGHVVNQLMEALMQLSRQQFPTMPVDYKRSIQRGILLLSNRLGQLVD 552
A2T3R5 468 FQVANWLHFVNYNQFRQVVIDGVLNQVLNDNIRNGHVVNQLMEALMQLSRQQFPTMPVDYKRSIQRGILLLSNRLGQLVD 547 Simian rotavirus A/SA...
Q91E96 470 RSIRQWLHHCNTLQFGRQITEGIIHLRFTNDIMTGRIVNLFSTMLVALSSQPFATYPLDYKRSVQRALQLLSNRTAQIAD 549 Human rotavirus C/Bri...
6OGY_C 553 LTRLLAYNYETLMACITMNMQHVQTLTTEKLQLTSVTSLCMLIGNATVIPSPQTLFHYYNVNVNFHSNYNERINDAVAII 632
A2T3R5 548 LTRLLSYNYETLMACITMNMQHVQTLTTEKLQLTSVTSLCMLIGNATVIPSPQTLFHYYNVNVNFHSNYNERINDAVAII 627 Simian rotavirus A/SA...
Q91E96 550 LTRLIVYNYTTLSACIVMNMHLVGTLTVERIQATSLTSLMMLISNKTVIPEPSSLFSYFSSNINFLTNYNEQIDNVVAEI 629 Human rotavirus C/Bri...
6OGY_C 633 TAANRLNLYQKKMKSIVEDFLKRLQIFDISRVPDDQMYRLRDRLRLLPVEIRRLDIFNLILMNMEQIERASDKIAQGVII 712
A2T3R5 628 TAANRLNLYQKKMKSIVEDFLKRLQIFDVARVPDDQMYRLRDRLRLLPVEIRRLDIFNLIAMNMEQIERASDKIAQGVII 707 Simian rotavirus A/SA...
Q91E96 630 MAAYRLNLYQQKMLMLVTRFVSKLYIFDAPKIPPDQMYRLRNRLRNIPVERRRADVFRIIMNNRDLIEKTSERICQGVLL 709 Human rotavirus C/Bri...
6OGY_C 713 AYRDMQLERDEMYGYVNIARNLDGFQQINLEELMRTGDYAQITNMLLNNQPVALVGALPFITDSSVISLVAKLDATVFAQ 792
A2T3R5 708 AYRDMQLERDEMYGYVNIARNLDGFQQINLEELMRSGDYAQITNMLLNNQPVALVGALPFITDSSVISLIAKLDATVFAQ 787 Simian rotavirus A/SA...
Q91E96 710 SYTPMPLTYVEDVGLTNVINDTNSFQIINIEEIEKTGDYSAITNALLRDTPIILKGAIPYVTNSSVIDVLSKVDTTVFAS 789 Human rotavirus C/Bri...
6OGY_C 793 IVKLRKVDTLKPILYKINSDSNDFYLVANYDWVPTSTTKVYKQIPQQFDFRASMHMLTSNLTFTVYSDLLAFVSADTVEP 872
A2T3R5 788 IVKLRKVDTLKPILYKINSDSNDFYLVANYDWIPTSTTKVYKQVPQQFDFRASMHMLTSNLTFTVYSDLLAFVSADTVEP 867 Simian rotavirus A/SA...
Q91E96 790 IVKDRDISKLKPIKFIINSDSSEYYLVHNNKWTPTTTTAVYKARSQQFDIQHSVSMLESNLFFVVYNDLFKYIKTTTVLP 869 Human rotavirus C/Bri...
6OGY_C 873 INAVAFDNMRIMNEL 887
A2T3R5 868 INAVAFDNMRIMNEL 882 Simian rotavirus A/SA11-H96
Q91E96 870 INAVSYDGARIMQET 884 Human rotavirus C/Bristol
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap