Conserved Protein Domain Family
DUF681

?
pfam05080: DUF681 
Protein of unknown function (DUF681)
This family contains several uncharacterized beak and feather disease virus proteins.
Statistics
?
PSSM-Id: 113835
View PSSM: pfam05080
Aligned: 2 rows
Threshold Bit Score: 182.941
Threshold Setting Gi: 81923886
Created: 11-May-2020
Updated: 6-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O90236   1 MGGACIASRYWLVPARVILRLRLTSFTGHRGVARVDGPMSSLGPNIIKCAVNGGMDMMGKMSSSWTTFMGGYLIARCSAS 80  Beak and feather dise...
Q9DXG1   1 MGGACTTFHYWLVPTHVTSRRKSTLCTAPRGVARADGPMNSLVLNFIKCAVSGGMDMTGKISSSLTTSMGGSLIARCSAL 80  Beak and feather dise...
O90236  81 ATVTHIKCQLRALLWSLRARG 101 Beak and feather disease virus
Q9DXG1  81 WTVTHIRCQLRAPLWSLPARG 101 Beak and feather disease virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap