6KCR


Conserved Protein Domain Family
MtlR

?
pfam05068: MtlR 
Click on image for an interactive view with Cn3D
Mannitol repressor
The mannitol operon of Escherichia coli, encoding the mannitol-specific enzyme II of the phosphotransferase system (MtlA) and mannitol phosphate dehydrogenase (MtlD) contains an additional downstream open reading frame which encodes the mannitol repressor (MtlR).
Statistics
?
PSSM-Id: 398648
Aligned: 20 rows
Threshold Bit Score: 180.518
Threshold Setting Gi: 668988486
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6KCR_C           37 RVLERLNAGKTVRSFLITAVELLTEAVNLLVLQVFRKDDY-AVKYAVEPLLDGDGPLGDLSVRLKLIYGLGVINRQEYED 115 Escherichia ...
USMARC:WQG_2880   6 DFIEQLSEKDNIHAFLALCCQKIADQIDCLIERVFRKQDF-ALKSVVDSLFEHQGPLADLSVRLKVLLGLGVISVECYQD 84  Bibersteinia...
Q9CLY6            6 PIYEKLNEATSIRGFITASVAIFDEAVDKLINRVFRKTDF-AVKSVVDSLLSNSGPLCDLSIRLKVLLGLGIIEHHVFSD 84  Pasteurella ...
Q65VJ4            6 PIYEKLNETTSIRGFITACVAIFDESVDQLINRVFRKTDF-AVKSVVDSLFINSGPLFDLSIRLKVLLGLGIISHETFMD 84  [Mannheimia]...
WP_012072218      6 PIYEKLNDVPSIRGFVTASVAIFDELVDLLINRVFRKNDF-AVKSVIDSLFETSGPLAALSIRLKVLLGLGVLSQEAFED 84  Actinobacill...
jgi:HSM_0827      6 PIYEKLNSTVSVRGFMIATVAIFEEAVDSLINRVFRKTDF-VVQSVIDSLFTNDGPLGDLSVRLKVLLGLGVIQHNLFSD 84  Histophilus ...
Q87IV3            6 ELLEKLDECENATAFLQVSNKIINLKLKALLPSVFVQDDL-VKEYAVDPLLREDGPLVTTDVVSKLMFAMGKISLQTYAD 84  Vibrio parah...
Q5E1G3            6 ELLETVEECDDATSFLCASNKLINLKLKALLPNIFVQDEL-VMEYAVEPLLKEDGPLVTTDVVSKLMFAMGKISLETYAD 84  Aliivibrio f...
KFD00602          8 QVLETLSGQTNLNDFLHAANAILLSGIKQFLPHLFINNDEdIREFAVKPLLAKSGPLDSIDVSLRLIYALGKIQKPVYAD 87  Rahnella aqu...
P11663            8 DVLEQLDAQDNLFSFMKTAHTILLQGIRQFLPSLFVDNDEeIVEYAVKPLLAQSGPLDDIDVALRLIYALGKMDKWLYAD 87  Escherichia ...
6KCR_C          116 AELLMALREELNHDGNEYAFTDDEILGPFGELHCVAALPPPPQFEPA------DSSLYA------------MQIQRYQQA 177 Escherichia ...
USMARC:WQG_2880  85 LSLLLRAEQIVKKE-HSLTFASPQVLKFAERLNLADVQQINGLIQSFptlndpNSLQYQ------------MQQMRIEKM 151 Bibersteinia...
Q9CLY6           85 ISHFIEIKEKLNNDEKEYDFADLIIIDFIQQLSCQNDKSLLNFPMEKde--npDSLLYQ------------VKALRREKL 150 Pasteurella ...
Q65VJ4           85 INAFIQLKEALNNDGKEYEFFDPIIISFIQGLNVRQDKSFLNLDTKIdg--tkDSLLYQ------------VKVLRREKL 150 [Mannheimia]...
WP_012072218     85 ISAFMQLKDKLNEDSREYHFSDELIVAFTHKLKLFKDKAMLPQHEMTea---pDSLVGQ------------VKIQRREKL 149 Actinobacill...
jgi:HSM_0827     85 VNAFIQFKETLNKDEKEYTFDDEIVLTFLQKLTLLMDKSALDFEPLIed---kNSLTYQ------------MKSLRREKI 149 Histophilus ...
Q87IV3           85 IGLYDQVLEYVVTQPEKIAFTDDVIYDFIKNQAVLSSQQ--------------DCFYLEsinqlkfssfesFSQMRYESL 150 Vibrio parah...
Q5E1G3           85 IGLYAQVLEYAQSQPNKLSFGDDMIYDFISNQAVLSTQQ--------------DSFYLEsinqlkfssfevFSQMRYESL 150 Aliivibrio f...
KFD00602         88 ILLFSQLDEHLKAGSDIVEFHEETAYEFIQNLSCVSH----------------NTLMFQsvekmkfagfdiFNNARYGNL 151 Rahnella aqu...
P11663           88 ITHFSQFWHYLNEQDETPGFADDMTWDFISNVNSITR----------------NAMLYDalkamkfadfsvWSEARFSGM 151 Escherichia ...
6KCR_C          178 VRSTMVLSLTELISKIS 194 Escherichia coli K-12
USMARC:WQG_2880 152 VRSCLILTVVELLEALD 168 Bibersteinia trehalosi USDA-ARS-USMARC-192
Q9CLY6          151 IRSYLTLAITEIYEQLQ 167 Pasteurella multocida
Q65VJ4          151 IRSYLILSVTDLYDQLQ 167 [Mannheimia] succiniciproducens MBEL55E
WP_012072218    150 VRSCLILTVTEIYQQLQ 166 Actinobacillus succinogenes
jgi:HSM_0827    150 IRSCLILTIADIYRQLQ 166 Histophilus somni 2336
Q87IV3          151 IKTVLKLSCEMLIERIE 167 Vibrio parahaemolyticus
Q5E1G3          151 IKTVLKLSCEMLLEKIE 167 Aliivibrio fischeri ES114
KFD00602        152 VRTALSLAVTDLLKELT 168 Rahnella aquatilis CIP 78.65 = ATCC 33071
P11663          152 VKTALTLAVTTTLKELT 168 Escherichia coli K-12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap