Conserved Protein Domain Family
DUF674

?
pfam05056: DUF674 
Protein of unknown function (DUF674)
This family is found in Arabidopsis thaliana and contains several uncharacterized proteins.
Statistics
?
PSSM-Id: 398643
Aligned: 29 rows
Threshold Bit Score: 459.447
Threshold Setting Gi: 1149807438
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_009139993   4 SVKFSLKLLVDEKRNKVVLAEAVHDFVDVLISLLSLPMGKIARLLESHkd--lqTVLACYQNLNRSVADMGIEHFET-EA 80  field mustard
XP_006583605  34 pgQVSLKLVVNKETNKVVFAEAGKDFVDVLLSFLTFPLGTIARLVQKDsdv-gpVQVGCLSSLYESVANLEKECLWT-EA 111 soybean
KRH01713       7 KHQVTLKLWVNKERNKVFFAKAEKDFVDVLISFLTLPLGTIVRLANKEsnm-dlVEFGSLSSLYKSVENLDNECLCT-DT 84  soybean
XP_002299837   1 maTISLKASVDKKSNRVVFVESDEFFVDILFSFLTMPMGTIIHLISNLspt---ngFVCMNNLYKSVENIDAMYFRT-EA 76  black cottonwood
XP_015169564  12 PKVIKLKIMIDKNRNRVIFAESDHEFIDALFSFLTLPLGTVLRLLEKDm-----VQLGSISRVYASVYSLEPRFLRT-SY 85  potato
XP_015158765  90 ESKVVLKLLVDEKKDQVVAAEAKVDFMDIFVSLLTLPLGTIIRLIKAEa-----GVVGCMNNLYQSVENLAVEDLFI-EH 163 potato
XP_006363077   6 EPKFLLKLLVDESKDQVVAAESGIDFMDILVSLLTLPMGTIIRLIKAKd-----GVVGCMNNLYQSVENLSEEDDMFlDH 80  potato
XP_003516931   6 EPKLSLTLLVDKERNCVVVAEASGDLIDILFSFLTLPLGTIIRLVSKKqghdeaDEIGCINNLYQSLENSGDEVFWN-HI 84  soybean
KRH48042       7 AAAVRWDLCQDNEKKRVVLAEASGDFIDVLFSFLTLPLGTIVRLLGNS------VEMGNIKKLYDSVKRLGSDVFWN-DI 79  soybean
XP_006583275   6 EATIPLRYWVDNEQKRVVMAEASGDFVDVLFSFLTLPLGTIIRLGNQFqq---pVQIGCINNLYESVQNLRPDVFWN-NI 81  soybean
XP_009139993  81 CKSMLLSPKSSYEIHCRKLKLNMGDTDAT-KFFICSSYlSddstCD----NVYSNFNTSTC-RCGGTMSTRMFTSd---E 151 field mustard
XP_006583605 112 CKEMLLQPRNSSEDYCRSLKLNIDDTEPT-KHFMCTSNlD----CAy---SQLSTYPNGRC-ACGFAMTTLVFVDdkvyK 182 soybean
KRH01713      85 CKEMLLRPRNSLEAYCRNMKLNIDDTEPT-KYLVCNDLvN----CRhyypVLLSTFRNKRC-SCGNTLGKPISPEsqcsN 158 soybean
XP_002299837  77 CKQMLLHPHNAAAAYCKSLKLKIDDIDTS-SFFCCESS-D----CThsgyKLWSHYKNLYC-GCGRPMSRNLNLSc---R 146 black cottonwood
XP_015169564  86 CKSMLIMPRNASEVQCEKLKLNVDYSENAgKLFVCNSY-Sp--rCK----NIFSISQNTQCfRCNRL---TQFDRkineK 155 potato
XP_015158765 164 CKTMLLNPRNPYPKYCMRLKVNIDDSGSE-KYYGCSGW-TtrkyC-----SKRSYFMNVEC-PCNGKFDKETILS----- 230 potato
XP_006363077  81 CKTMLLNPRNPYPKYCMRLKVDVNDSGSE-KYYQCPS-------C-----PNKSYFMNVDC-PCYGQFNKETFLK----- 141 potato
XP_003516931  85 CKRMLLCPRNPCEALCQKLKVKLDDSKPM-KYFMCSSR------CRrggdWFLSTFAEASC-HCGKLMDKEMKQH----- 151 soybean
KRH48042      80 CKQMLLNPRNPLEASCQRLKVKVDDTKPT-EYFMCHS-------CSaeknLLLSTFDGGRC-YCGKLMRKNMDLL----- 145 soybean
XP_006583275  82 CQKMLLAPRNPLEASYQRLKVKVDGTEPT-KYFMCHS-------CSkgsdLLLSSFDGAWC-SCRKLMRKKMELL----- 147 soybean
XP_009139993 152 DQIGEEIGNSVDGVFVNC-RSSFIVTDDLKVSVNSIGVVMNVLNDLGYTDFSDLQETLLDIGFEEVVTLLGCFFTTETPL 230 field mustard
XP_006583605 183 G-------------FVNG-GATFIVTDDLVVLPNTMDTGLSFFQSCGVKCLSSVQTITLTVTKKKVLDLLKCSLLSKSTL 248 soybean
KRH01713     159 VFDG----------FVKS-NATFMITDDLKVLSDSLNTILSVLMSSGLENASLLTEMTVSITKTQVIHLLKSCLLSKTTL 227 soybean
XP_002299837 147 APSNSGSDARNRGVFVEG-LTRFVVSDYFQVTPASISASIALLTKLGVMDTDNIEERIFDIGVTEVLELLECSLVSRTPL 225 black cottonwood
XP_015169564 156 EEKRSCRGESVVEVFLKGgAASFMITDDLQVMPASTARLTSLFGKLGVSDKSEIEAKTVEVGTDEVLQLLKFSLLSKTAL 235 potato
XP_015158765 231 ------ESCRDKYVFLIG-GISYLISDDLQFKRASPSTLFQMLSNVGLSDMNQIKEMNVEVGRNEVIRLLARSFISKTPL 303 potato
XP_006363077 142 --DLVENTCRDEYVFLKE-GISFLISDDLQVKSASPSSLVQMLSSVGLSNLNQIKEMHIEVGKDEVIHLLARSFISKTPL 218 potato
XP_003516931 152 --GDSNEGTHGDGVFVKG-QTMYLIFDDLRVLESSPGNSAQQLVQLGYKNFQKLIKRSLNVGIKEILDILKHALTSKSPL 228 soybean
KRH48042     146 -VESKEETAAENGVFVKG-DAKFLIFDDLTVLRSTPSKSVQKFLEHRRKDL-KIPTISKDVDMKEILSILKQALISKSPL 222 soybean
XP_006583275 148 -EESKDEASGVDGVFVKG-DAMFLIFDDLKVLRSSPSDSLQTPLLFGHTDFSKMQEMSQDVGPREIFSILKHALTSKSPL 225 soybean
XP_009139993 231 TCAFLmkp--------clTRKLKMLSPHLQNSE-IVEPSSVFSVKLFVRKFDNEILYAECNADFIDALLSFLIFPLELIC 301 field mustard
XP_006583605 249 TDLFLvkkp-----flenSSFSPAVV--------ENSSTIQIKIKLVMRKSDGKILFAEGEEDFADFLLSFLTLPLGGVV 315 soybean
KRH01713     228 TDTFLvekp-----ylerFNKIKLAPLDL-----NTNGSGKINIKIMQRKSNGKILFAQGKEDFANFLFSFLTFPLGAVV 297 soybean
XP_002299837 226 TEVLLarkevpelrnedsLQRISLMHEILEH---QSERNAEMSVRLVVCKSKKVVCYAEASKDFVDLLFSFLTIPLGYLM 302 black cottonwood
XP_015169564 236 TNMVLnsqgs----wlkdISKYEDNQTAKLDKKtMSQNTNSMSLKLIVSKSKKKVLYAEAGVKLVDFLFSFLVFPLGAVV 311 potato
XP_015158765 304 SDVFLpkqkqkraqvdtiIMSESGNLSSISENG-TSNNTKKLELKLTVRKSTNKVLCAEAGNDFIDFLFNFLTIPIGSIE 382 potato
XP_006363077 219 SDVFLpkqnkkrdrvgttTVTEFGNLPSISENR-TSNNTMKLELKLTVRKSTNKVLCAEASNDFIDFLFNFLTIPIGSIE 297 potato
XP_003516931 229 SDVFLgngv-----skrmCAFSPKPRPENQG---WKNYNSMINIKVTVRKSKKTILYAESEGDFVDFLFSFLTTPLGSIL 300 soybean
KRH48042     223 SEVLFekegskscscpysCPCSRNTNP--------IHWKDSIKIKVMVNKSNNKILLAEADGDFVDFLFSFLTTPLGSIL 294 soybean
XP_006583275 226 SDVFIpnrkk----iepsYSFSPDTGP--------SHWKGSVEIKLMVSKSKNKVLFAEADGDFVDFLVSFLTTPLGSIL 293 soybean
XP_009139993 302 SLSN---NLGSVGNLSRSPCRKASASDFNQ-------------------------VPDYyGCSNNTMFGYLPSPSPVYEC 353 field mustard
XP_006583605 316 RMLGgysSMGSVDGLYKSIADLNENKYLISekvknr-------------lvdpglAPQFqTKIANQMLPICEQISEYYYC 382 soybean
KRH01713     298 QLMEccsSIGSVDALYKSIVDLDED-YWTTketkhk-------------vvhpviAPQF--KLTNQLLPICDAPIPEYFC 361 soybean
XP_002299837 303 NEKHggkSKGCIHHLYDSVIDLDARTYLKSndikei-------------llnpeiAPGS--GYKNQPLGVKEAVDNQQYY 367 black cottonwood
XP_015169564 312 KHLGgnsRLGCIDNLYKGAVELSSENYIKSeecknm-------------llspklFPHS--GFDSHILEVEEEYPKYRYd 376 potato
XP_015158765 383 DVLKgssGLRCIDNFYKSVEALDLKWFNKRpkqnsyqsedkfkdnlktillkpnvATHY--NSEYQLLQISEGESEFY-- 458 potato
XP_006363077 298 DVLKgnsGLGCIDNFYKSVEAVDLKWFNTPsnrnsythekn----vktillnpgvAPHH--KSEYQLLQISERRSEIH-- 369 potato
XP_003516931 301 KLLDgnfSLGCMNSLYESVKDLNPSWFTNPsgtpl---------------lnlrvAPQF-GCKRQPTQLCEEDTPCYWYG 364 soybean
KRH48042     295 NLTNgkfPLGSIGNLYRSVKRLDPSWFKGSskesl---------------lnlrvAPHF-GCKSSPF--QEDHTPNYWYG 356 soybean
XP_006583275 294 NLMNgksSLGSIDNLYASVKKLNASWFIGSsnksl---------------lnprvAPQF-GCGSNPLNASQEYTPTYWYG 357 soybean
XP_009139993 354 FVPR------------------NSSDSWSCQLArqiqwsmdlfilGGDIVKMSPNNPK-VISGsSSGGDTGFMKKNTKFI 414 field mustard
XP_006583605 383 YPFDhytefifrnqfyktdyyeYENYEKFERY--------------TR---LVLVDPK-SSEG--SIEGNGYAKGPAMFM 442 soybean
KRH01713     362 FTKDvyderdcqrkliswfltsERTRRKRRTET------------CEG---MKFVDPI-SESG----KGEGFAKGPTMYM 421 soybean
XP_002299837 368 YEWHfpasir------tesicpHGSTLQL----------------------LTIMDPK-SPYK-EGTEGDGFLLDPAMFT 417 black cottonwood
XP_015169564 377 ----------------------DSGCIELARNTnksegssivneeEASDLAINILDPK-SPTG-ETIKGEGYLKGPATFM 432 potato
XP_015158765 459 ----------------------------------------------------DLYDPRqHIRGsHVPKFHKFAKEPSAFY 486 potato
XP_006363077 370 ----------------------------------------------------SLYDIRqYVRGaYVEKFEKFTKEPSLFY 397 potato
XP_003516931 365 TGVIksnicys-----igngvvSKDHSLIQHP--------------GA---MKLFDPR-SPNG-TKESSVGFVRRPSLFV 420 soybean
KRH48042     357 TVAGndnne--------grtmiSKKKDMLQTA--------------KE---LKLFDPR-CSDG-AKEPGVGFVKRPCLFV 409 soybean
XP_006583275 358 TVVVkdnne--------grtmiSKKKEMLQYP--------------AK---LKLFEPR-CYDG-AREAAVGFMKRPCLFV 410 soybean
XP_009139993 415 VSNDLIISPMNSFSTVGLLKKM--QVNISDLEEHQISISK 452 field mustard
XP_006583605 443 ATDDLVVAPMSPISGLSLLSRL--NIPLSDLKEKVVVIGI 480 soybean
KRH01713     422 ATDDLVVTPMSSDSLLSLLNRT--NILVRDLEEKEVSIGV 459 soybean
XP_002299837 418 VSDDLVVTPISPVSELSLLEKL--KIPFNDIYVCEVQVGR 455 black cottonwood
XP_015169564 433 IMDNLLVTPFSPTAIITQLNQM--KVSTSDVEERTVTVGK 470 potato
XP_015158765 487 VMDNLEVRPLSSTSTICLLQEL--NVPMNDIEEQMISVGE 524 potato
XP_006363077 398 IMDHLEVRPLSSSSTICLLQEL--NVPINDVEEQTISVGE 435 potato
XP_003516931 421 VWDDLQVTPLANTSSISLLQKL--NVPLDNLEEHELRIGE 458 soybean
KRH48042     410 VMDDLEVKQMTTTSSIEYLNNLgdDVKLGDLEEHLVEIRS 449 soybean
XP_006583275 411 VSDDLKVRQLTTTSSIQYMQELg-NVKFDDLKEHMVEIRK 449 soybean
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap