Conserved Protein Domain Family
RgpF

?
pfam05045: RgpF 
Rhamnan synthesis protein F
This family consists of a group of proteins which are related to the Streptococcus rhamnose-glucose polysaccharide assembly protein (RgpF). Rhamnan backbones are found in several O polysaccharides of phytopathogenic bacteria and are regarded as pathogenic factors.
Statistics
?
PSSM-Id: 398636
Aligned: 14 rows
Threshold Bit Score: 660.56
Threshold Setting Gi: 81533810
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
KUCSBL:ELI_3842  41 ILIACNGKVCQEGKEKFKS--ITSNILIRENIGFDVWAYKESLAYYGWDKLEEFDEVVMLNFTIMGPIYPFSEMFSIMD- 117 Eubacterium ...
jgi:Namu_4195    34 IFVVSNSTLTPEGREKLAD--VADTVLARENVGFDVWGYKEAMEAFGRDRLAEYDELILMNYTFFGPIFPFAETFTAMDa 111 Nakamurella ...
CDF43392         41 ILVVCNGKLTSEGRKKLEE--VTPNVLVRENKGFDVWAYKTGLEHYGWDKIKSFDEVIMMNFTIMGPVYPLEEMFHAMD- 117 Roseburia sp...
WP_011743785     41 mTIVCNGKLNEAGQSILSR--YTDNLIIRPNTGFDVWAYKTALDSYGWEKLEQFDEIVLFNATIMGPVYPFAEMFETMN- 117 Bifidobacter...
CDE53020         41 lLVICNGDVEEEAGKRFSG--IADEVMMRGNEGFDITAYHLGLKKYGYNRDGKFDEVIICNSTMFGPVYPFQEMFEKMA- 117 Roseburia sp...
CDF43391         36 IVVVSEGTLRQEAKKKLAF--YAEEILEYPRGGRMTEAIRAVAEAFGWDRLGYYKEIVWVRDTVMGPLVSLGSVFRQME- 112 Roseburia sp...
CDE80002         34 ILVVINGKLAPESRDRLAD--VCDDMFVRKNEGFDAWAYKDGIEYIGYDGLKEYDELILTNNTVYGPLRPLKDVFAEVE- 110 Ruminococcus...
Q5M3F8           34 LVFISNSRLSESEVQKLRDkhLIDDFIQRENKGYDFAAWHDGMEFVGFENLKQYDSVTVMNDTCFGPLWDMAPIYDNYEs 113 Streptococcu...
Q8DUS1           34 VIFISNSQVADADVKMLREkhLIDDFIQRQNSGFDFAAWRDGMVFVGFDELVTYDSVTTMNDTCFGPLWEMYSIYQEFEt 113 Streptococcu...
CAR41606         34 LIFISNSSLNDSDRQELLSsgLVNEVIQRQNIGFDFAAWRDGMATVGFESLSEYDNVTIMNDTCFGPLWDMKPYFLTYEd 113 Streptococcu...
KUCSBL:ELI_3842 118 QKDLDFWGCTK-----------HHKI-PFDPFGrlSCGYIPEHIQSHFIAVRKSMLQSESFKNYWENMPMINDYFDAICC 185 Eubacterium ...
jgi:Namu_4195   112 REDIDFWGLTA-----------HGEV-DPNPFPd-TTGTLPLHIQSHWIAVRKTMFTSIEFAWYWDKMPMVTSYTDSILQ 178 Nakamurella ...
CDF43392        118 KRDLDFWGITK-----------FHEFkDGDPFGtiPYGYIPAHIQSHFIAVRKPMLNSLEYQSYWDNMVMIHDYREAVGC 186 Roseburia sp...
WP_011743785    118 KRDLDFWGITK-----------FHKV-PQDPFGrsPFGYLPEHIQSHFHAYRRSLVQSKEFQDYWNNMPQINSYYDSVGM 185 Bifidobacter...
CDE53020        118 VRDLDFWGITN-----------FHEV-PFDPFGtvKYGMLPKHVQSFFMVFRKSLTMSPEFQKYWENMPQITSYEQAIGY 185 Roseburia sp...
CDF43391        113 QKRADFWGISE-----------SFLR-EGAGEGenRNGYFPEYLDDYFLVFRKELVMSREFQDYWEN-----------ER 169 Roseburia sp...
CDE80002        111 NVSCDFWGLQMsygdpeekvylNRTL---------PWGCRPDAIISNFRVIRSKCLHSIEFARYWQELAPVNNYTDAVYI 181 Ruminococcus...
Q5M3F8          114 NPNVDFWGMTN-----------HQGIkA-------GDIYIHEHLQSYFISFKKRLVESSVFQKFWKSVESFEDVQKVIDN 175 Streptococcu...
Q8DUS1          114 KTTVDFWGLTN-----------NR-----------ATKSFREHIQSYFISFKASVLRSTAFRDFWENIKEYQDVQKVIDQ 171 Streptococcu...
CAR41606        114 DEEVDFWGLTN-----------NR-----------QTKEFDEHIQSYFISFKKTVLSNETFLHFWRTVQDFTDVQDVIKN 171 Streptococcu...
KUCSBL:ELI_3842 186 HEAIFTQTFEKKGFSWDVYVGTDDLr---eYTYYPLQMVPRELVENrRCPIIKRRSFFHNfsDYLDYTAGEPAYELMEYI 262 Eubacterium ...
jgi:Namu_4195   179 HESKFTQHFADRGFRYSILFDPSRY-----PTTHPVFDSADLMLGD-RCPILKRRMFFHE--PTYLERNAILGRRVMEIV 250 Nakamurella ...
CDF43392        187 HEAIFTKKFSDAGFKWDVYADLEEG-----YNNHPVLCATRRMIEEkRCPIFKRRSFMQNydNILHDTAGENAIEAYEYI 261 Roseburia sp...
WP_011743785    186 HESLFTKRFADLGFKWDVYVNTDDLe---gFTYGPITFAAKTLIKEkRCPIFKRRSFFHDymDTLNQSAGNAALDLFEYL 262 Bifidobacter...
CDE53020        186 HEAIFTKEFADKGFQWAVYADSEELe---gYTYDPLRDFPRLMIEEkRCPVIKRRSFFHEygEALSRSGGEGTREAMEYI 262 Roseburia sp...
CDF43391        170 YDSGFTRKFANLGFEWDVYLDTKEYl---dITYEPILTQAVSMIEKkGCPFFAMDAVVRDytDALLESSGEEGRALVECL 246 Roseburia sp...
CDE80002        182 GELQFSYDMTNAGF-VSYSLDRGEYr---gASPSPTIHNAYDQISRlKIPYFRKRIFSSPlsHYTDCMNGTEPAKVLAYV 257 Ruminococcus...
Q5M3F8          176 YETLYTKKFRDAGFNYESILNTIPLnd-kfFHSNFTIHYPHVLLDT-GVPFIKVKTF---------DLTQHLAPYLLKEI 244 Streptococcu...
Q8DUS1          172 YETKVTTTLLDAGFQYDVVFDTTKEdashmLHADFSYYNPTAILNH-RVPFIKVKAI---------DNNQHITPYLLNDI 241 Streptococcu...
CAR41606        172 YETQVTTGLLKEGFRYKCIFNTVTAdasgmLHADFSYYNPTAILKH-QVPFIKVKTI---------DANQSIAPYLLQVI 241 Streptococcu...
KUCSBL:ELI_3842 263 EHfTTYDTNLIWQNILRTMHQADFKRALQLNYILSsefsyDSKKILC---EKRIAAIFHLYFEDLIDETYRYLSSMPEEA 339 Eubacterium ...
jgi:Namu_4195   251 SR-TDYPVDLIWRNVVRSAEPRTLYTNMSMLSVVP-----DVDTGFRpdpPLRICVLAHIFYEDMTDEMMGWIGNIPVPF 324 Nakamurella ...
CDF43392        262 DRhTDYDVDMIWQNILRLENQADIKKNMQLNFVLPedmskPADDILK---NRKVALVLHFYFEDLAEYCLHYVQSMPPEA 338 Roseburia sp...
WP_011743785    263 RDhTDYDVNLIWQNALRTMNLADLVKNLHLDFVMPsnittPIPE------GKRIALIMHLYYMDLLDKTLEYAKSMPEGC 336 Bifidobacter...
CDE53020        263 EKhTDYDTSMIWKNILRLQNMADVKKRMHLNYVLPtg--iRLNKEEK---KLKTALVIHIYYEELAAMCAEYAANVPENV 337 Roseburia sp...
CDF43391        247 QRqNGFDMDLFWQHVLRVGNIADIQKNICANYILSg----QTSNRKKeagQLRIALVIHIYFPELVEECYQYAQSMPEYA 322 Roseburia sp...
CDE80002        258 KDhTDYDTDMIWENLIRTVNQYDLHHMLGLTEILP-------YDRSShvtNSRIAVIFHAYYTDIFTKYIPYLESFPAGT 330 Ruminococcus...
Q5M3F8          245 EKrTDYPVELILSHMSDMSLPT-------PPYLLDrkvieKSSQTYSd--TKKIAVHLHTYYVDLLEDFLKQFENFHFTY 315 Streptococcu...
Q8DUS1          242 QKnSTYPIDLIVSHMSEINYPD-------FSYLLGhkyvkKRERVDLk--NQKAAVHLHVFYVDLLEEFLTAFKQFHFSY 312 Streptococcu...
CAR41606        242 KNqTDYPVDLIVSHMSDIHYPD-------APYLLSqkyleKQEESDLkvsEHSIAVHLHVFYVDLLEEFLHAFTSFKFPF 314 Streptococcu...
KUCSBL:ELI_3842 340 DIYITTDTEPKKKLIQEKFKDFSc-RNFKVILI-QNRGRDVSALLVATKAFIMN--YDYVCFAHDKK--VTQTKPySIGG 413 Eubacterium ...
jgi:Namu_4195   325 DLVVTTTSAAKKEAIESALEAYAl-KSVEVRLVeSNRGRAESAFLIACRDVLTSgeYDLVLKIHSKK--SPQNGA-NLGQ 400 Nakamurella ...
CDF43392        339 DIYVTTGSEKKKELIEKTFSVLP--NKVKVILI-ENRGRDVSALLVGTKDFIMD--YDYVCFVHDKK--VTQLKPdTVGA 411 Roseburia sp...
WP_011743785    337 DFIFTVGSEENAKLVRERCKGLP--YNVDVRVI-QNRGRDVSALLIGAGKDCLK--YDYVCFAHDKK--VTQLSPySIGD 409 Bifidobacter...
CDE53020        338 DIYVTVPDEKKLENAKNAFAGVKn-HTIDYRIV-GNIGRDVAPFLVGCKDLIDK--YDLIAKVHDKK--VYQVVPmSIGD 411 Roseburia sp...
CDF43391        323 DVYITTDSEEKKKVIYEKFRHLNc-GKLDIRVV-PNCGRDVGPFLVETGTYFRE--YDLICHTHDKK--AGQVRPgSIGL 396 Roseburia sp...
CDE80002        331 DIYFTVGSEEKEKLFREMTAELSkkYKITFIPI-ENTGRDVSALLIGGRDVILNggYDYICFMHDKKgiGARGSYeCVGS 409 Ruminococcus...
Q5M3F8          316 DLFLTTDSEDKKAEIQSILDKNG--KVARIFIT-GNRGRDVIPML-KLKDELSA--YDYIGHFHTKK--SPEYPY-WVGD 386 Streptococcu...
Q8DUS1          313 DLFITTDSDDKKAEIEEILSANS--QEAQVFVT-GNIGRDVLPML-KLKNYLST--YDFVGHFHTKK--SKEADF-WAGQ 383 Streptococcu...
CAR41606        315 DLYITTDKSEKESEIKAILDSFR--VSAKIVVT-GNIGRDVLPML-KLKDELSQ--YDYIGHFHTKK--SKEADF-WAGE 385 Streptococcu...
KUCSBL:ELI_3842 414 AFAYKCFENTLQNKNFVLNIINAFEKNPRLGMLMPAPPNNGpyYPTLGN-EWMCN--YEVTKNLIDE-LGI--KVPMDPG 487 Eubacterium ...
jgi:Namu_4195   401 LFKHHSVDNLLSSPGYVASILGMFQSQPSLGMVFPPVVNIG--FPTLGH-SWFTN--REAAHELADQ-LGI--HTIFDRT 472 Nakamurella ...
CDF43392        412 SFSYKCFENLLTSRDFVNNVLHTFEANPRVGLLTPPPPNHGdyYITVGL-EWGKN--YKITKKLAEK-LGI--TVPIAEE 485 Roseburia sp...
WP_011743785    410 GFAYKCFENILGSKALVSNIINHFEQDPHAGLLAPTSPNHAdyFGNFAS-LWGPN--FEGTKKMLEEtLGV--KVPLNPY 484 Bifidobacter...
CDE53020        412 SWGHMCFENMLKNTTYIDNVIATFEENPFLGLLTPPVPVHGpyYPTTGKgEWGDN--FKVAKELAEK-LGL--KVDMNPE 486 Roseburia sp...
CDF43391        397 AFSDRCFHNSLRSKAFVENIIQTFEDHERLGILMPPPPNHSayYFTLGK-GWSVN--FKVTKELADR-LGL--LVDLDET 470 Roseburia sp...
CDE80002        410 AFSETCFDNTAITSDYVNNVIELFDTDPHLGIASPPPPTHAa-YFRFADgDWGEN--YEMVCDLVKK-YGF--NVPIAQN 483 Ruminococcus...
Q5M3F8          387 SWRNELFSMLIQ---PADNIIANLERDDRLGLVIADIPSFFr-YTKIVD-PWNENrfAEGMNDLWER-MDLgrDIDFDKM 460 Streptococcu...
Q8DUS1          384 SWREELIDMLVK---PADNILAQLQQNPKIGLVIADMPTFFr-YNKIVD-AWNEHliAPEMNTLWQK-MGMtkKIDFNAF 457 Streptococcu...
CAR41606        386 SWRNELIDMLIK---PANTIINQFE-DPAIGIIIADIPSFFr-FNKIVT-PLNEHliAPEMNKLWEK-MNLskTIDFEQF 458 Streptococcu...
KUCSBL:ELI_3842 488 KePISPLGTMFWFRPKALKVLFDKNWEYSDFPEEPNK-VDGTLLHAIERAYGLIVQSE 544 Eubacterium callanderi
jgi:Namu_4195   473 T-PLAPNGTMFWARPESLAKLARHDFDYSQFAAEHEGwSDGMLGHVIERLYGYAVLDA 529 Nakamurella multipartita DSM 44233
CDF43392        486 KePIAPLGTMFWFRPKAMKLLFDQDWEYTDFPPEPNK-TDGTLLHAVERIYSYVVQQE 542 Roseburia sp. CAG:182
WP_011743785    485 KePIAPLGTMFWFRPKALHQLFDIDWKYEDFPPEPNK-IDGSMLHFIERAYGYLPQAN 541 Bifidobacterium adolescentis
CDE53020        487 KePVAPLGSMFWVRTKALKGLFDYGWEYTDFPPEPIE-TDATVLHAIERIYPFCVQNE 543 Roseburia sp. CAG:303
CDF43391        471 KePVAPIGSTFWVRPKALEKLLGHEWKYENFPAEPLP-WDGTVLHAVERIYGFCAQDA 527 Roseburia sp. CAG:182
CDE80002        484 KpPVAPLGTVFWFRAKAMEKLAKINWKYSDFPTEPAP-PDGSIMNAIERLYSIAVQDA 540 Ruminococcus sp. CAG:353
Q5M3F8          461 NtFIMSYGTFIWFKYDALKPLFDLDLQDEEIPAEPI--PQHTILHSIERILVYLAWAR 516 Streptococcus thermophilus LMG 18311
Q8DUS1          458 HtFVMSYGTFVWFKYDALKPLFDLNLTDDDVPEEPL--PQNSILHAIERLLIYIAWNE 513 Streptococcus mutans
CAR41606        459 DtFVMSYGTFVWFKYDALKPLFDLNLKDGDVPKEPL--PQNSILHAVERLLIYIAWDS 514 Streptococcus uberis 0140J
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap