Conserved Protein Domain Family
Pecanex_C

?
pfam05041: Pecanex_C 
Pecanex protein (C-terminus)
This family consists of C terminal region of the pecanex protein homologs. The pecanex protein is a maternal-effect neurogenic gene found in Drosophila.
Statistics
?
PSSM-Id: 398632
Aligned: 17 rows
Threshold Bit Score: 269.594
Threshold Setting Gi: 121903772
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EKC21095     1733 DSGKNSSLVSLCLCLGLLGRRALGTAAHNntTAAGAEFFLYGLHALFKGDFRITSPHDEWVFADMELLRRVVAPAIRMAL 1812 Pacific oyster
XP_015791604 1306 DAQDKEAVVSLCFALSLLARRALSAASHNn-SFNTVEFLLFGLHSLFKGDFRITSPRDEWVFKDIDLLKKVIAPSVRMAV 1384 two-spotted s...
XP_009009595  758 DTTCDSFLATLCYTLSLLCRRSLYVDAHHnsSINDIQFFLYGLYNLFKGDIRINSLKDEWVFMDMQLLKRVVAPAVRMAL 837  Helobdella ro...
XP_975582    1782 DSGNNSTLVLLCFALSLLGRRALGAVSHN--TVSSVEFFLFGLHALFKGDFRITCARDEWVFTDMDLLKTVVAPGIRMSL 1859 red flour beetle
CDS35791     1929 DASDESDLMTLCYAVSLLGRRCLGGVSGH--LNNALETFLHYLHDVFKGDVQISA-KDDWVFADVELLRVVVTPAMRVAL 2005 Echinococcus ...
EFC40202      354 DENKKLNIQKLAYLASLTARRALASFDGSn-SANSLRTFIQKVHQLFVGDYRITSTNDEWVFGDLSILDHCIKPAIGMSL 432  Naegleria gru...
EGD78807     2567 DSGRDSVVTKFVFLVCLLARRMM--LDRArrMSHVEDSFIHGFHGLFRGRLQPDNYKDEWVFFDPTILTEVVFPGARMGL 2644 Salpingoeca r...
EAY08733      821 DFIEKTGKTAVKREILAVSQILVn------eMNKYQGDFEWKLFKFFSSS---TMHLQNYLWIPARVNEKIVA-SFRSAV 890  Trichomonas v...
O61825       1001 DKYDHEEAVTLCFLLSLVARRSLGTASFNr-HSSAAESFLYGLHSLFKGDFRITCQRDEWVFTDMDMLRCVVSPAVKMAL 1079 Caenorhabditi...
XP_026694133 1464 NYSGDSKLTTLCFAISVLARRALGTASHN--LSSNLDSFLYGLYSLFKGDFRITSNKDEWVFTDMNLLREVVAPGVRMAL 1541 vase tunicate
EKC21095     1813 KL--HQDYYLFTDEYEDHETLYNAISNYEQ-----TLVISHEADPQWRNAVLS-NTPSLLALR-HVFTDTeiSDKYKIIM 1883 Pacific oyster
XP_015791604 1385 KL--HADHFMSTDEYDDNIVLWASISSYRQ-----NWVISHEADPIWRNALLS-NVPYLLALR-HVTEDG--TNQYKIIM 1453 two-spotted s...
XP_009009595  838 KL--HQDHFISPEEYVRNQSLYDSIASYEN-----DMVISHEGDPAWRNAVLS-NVQSLLSLR-HVMDEG--NNEYKIIM 906  Helobdella ro...
XP_975582    1860 KL--HQDHFMSPDEYEELPALYDAICKHEE-----ELVISHEGDPAWRNAVLS-GTPSLLALR-HVLDDG--SDEYKIIM 1928 red flour beetle
CDS35791     2006 KL--YQDHFTWNPLSTNQE-LYRAIWSTTQ-----TVVICHETDPQWRSAVLN-DAERLFSFR-RI-DSGttQQCFRFIM 2074 Echinococcus ...
EFC40202      433 SL--YQSKFAAED-VDLPDVVSTLIKY--------DMVITHESDPKWRESIMAeEAAELFSLRkKVQDKG--GVDYYILM 499  Naegleria gru...
EGD78807     2645 RL--RQDHFTDPDEYTDVENLWDSLDDYDSskgplRLRIYNETDPRWRESVLN-AFPSLLSLR-WNIEDSsaNKEFFVVS 2720 Salpingoeca r...
EAY08733      891 SIavHHAAGTLPDEFDE---LLDMIKESVT-----QRHVLPESDPRWAPLIQN-KEPELETMR-QYQDQD--EVSVKYMM 958  Trichomonas v...
O61825       1080 KL--HQDHFAQFEEFDENDGLYTVIGEYQT-----KMFISHEQDPGWRQAILA-NTPSLLALR-HIYDDG--QDDYKIIM 1148 Caenorhabditi...
XP_026694133 1542 KL--HQDHFACPDEYDQHEPLYTAISEYQT-----TMVITHEGDPMWRKAVLS-NTSSLLALR-RVISDMf-VDQYSVIT 1611 vase tunicate
EKC21095     1884 LNKKFLSFRIVKVNRECVRGLWAGQQQELIYLRNRNPERGSIQNAKQALRNMINSSCDQPIGYPIYVSPLTTSYSSTHTQ 1963 Pacific oyster
XP_015791604 1454 LNRRHLSFRVIKVNRECVRGLWAGQQQELVYLRNRNNERGSIQNAKQALRNIINSSCDQPIGYPIYVSPLITSFGETNPQ 1533 two-spotted s...
XP_009009595  907 LTKKYLNFRVIKVNSECVRSFWSGQLQELIFLRNNNSERGSIQNAKQSLRNIINSSCDQPIGYPIYVSPLTTSYLGTNPQ 986  Helobdella ro...
XP_975582    1929 LNKRYLSFRVIKINKECVRGLWAGQQQELVYLRNRNPERGSIQNAKQALRNIINSSCDQPIGYPIYVSPLTTSYAETNEQ 2008 red flour beetle
CDS35791     2075 MNKQILSFQVIKLNSECVRGFWAGQLREQIFLRNNNAERGSIQHAKHVLRNLINSSCDQPVGYPIYVSPLITSFVESHLQ 2154 Echinococcus ...
EFC40202      500 LSMRDIEFNIVKMNREGVRALWSSQQHELLYLGVEEAERGSIQNMTYTLRNICNSCMDVPIGYPVMVSSVTTAYW----- 574  Naegleria gru...
EGD78807     2721 LVRQRRSYKVFKVNRESVRGLWAAQQQEVIYFKTTHSERGSIQNAKCVLRNLISQSNDQPVGYPIYVSPIITSFACKPDM 2800 Salpingoeca r...
EAY08733      959 FTRRQQKFKVIEINGELVRGIWASEINETVFMESTDRERPSIQFDSFLLRNIIAQSANSPVGYPEIVCPISFSYSDFLK- 1037 Trichomonas v...
O61825       1149 LNQMHLNMRVIKLNRECVRAFWAGQQQELIFLRNRNPERGSIQNARQVLRNMINSSADLPVGYPIYVSPLTTSHIESHSQ 1228 Caenorhabditi...
XP_026694133 1612 LNHRALGFNVVKVNRECVRGLWAGQQNELIFLRNRNPERGSIQNAKQVLRNMINSSCDQPIGYPIYVSPLTTSYATTNQQ 1691 vase tunicate
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap