Conserved Protein Domain Family
Agouti

?
pfam05039: Agouti 
Agouti protein
The agouti protein regulates pigmentation in the mouse hair follicle producing a black hair with a subapical yellow band. A highly homologous protein agouti signal protein (ASIP)is present in humans and is expressed at highest levels in adipose tissue where it may play a role in energy homeostasis and possibly human pigmentation.
Statistics
?
PSSM-Id: 398631
Aligned: 15 rows
Threshold Bit Score: 77.5568
Threshold Setting Gi: 597790408
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAH28705      49 ADRARYPSLlhkakeasvelAGALPRPDLDQM-ALEVqeGDGNLLQkssvlEPQALStalqaAGREERsSP-RRCVRLLE 126 chicken
XP_007992147  34 PDQALFPEL-----------PGLGLRAPLKKT-TAEL--AEEDLLQ-----EAQALAevldsQDREPR-SS-RRCVRLHE 92  green monkey
XP_003472066  34 PDQVLFPDF-----------PGLGQHVPLKRT-TAEQ--AEEALLQ-----KAEALAevldpQNREPR-TP-RRCVRLQE 92  domestic guinea...
XP_007258567  43 QNHTSSPSI-----------LIVELSNSSKKS-KTSE--KKQKKMQm---kLNGQVK----------RpLPpPNCTPLWG 95  Mexican tetra
XP_005057048  49 mdlsDLPPI-----------SIVDLTRKSQKV-SRKE--AENK-KSs---kKNAKRK-----ISPKPRpPPaANCVPTFK 105 Collared flycat...
ACC91748      42 MNLLDFPSV-----------SIVALNKKSKKI-SRNE--AEKKKRAs---kRKAPMK-----NVARTRpPPpTPCVATRD 99  sheep
P42127        42 VNLLDVPSV-----------SIVALNKKSKQI-GRKA--AEKK-RSs---kKEASMK-----KVVRPRtPLsAPCVATRN 98  human
NP_001116411  42 TNLLEFSSV-----------SIVALNKKSKDI-SIKE--AEKKKRSs---kKKASKK-----KVARPRpLLpAPCVATRD 99  rabbit
XP_003411713  42 mKLLDFPSV-----------SVVALNKKSKRIlSRKE--AEMMKGPs---kKKASVK-----KAARPRpPPpAGCVATRD 100 African savanna...
XP_853932     34 PDQALFPEL-----------PGLGLQSSLKRA-TAEQ--SEEALLQ-----EAEALAevldpEGREPR-SP-RRCVRLHE 92  dog
BAH28705     127 SCLGHQIPCCDPCATCYCRFFNAFCYCRkI 156 chicken
XP_007992147  93 SCLGQQVPCCDPCATCYCRFFNAFCYCRkL 122 green monkey
XP_003472066  93 SCLGQQVPCCDPCATCYCRFFNAFCYCRkL 122 domestic guinea pig
XP_007258567  96 SCKDPNSVCCEPCAFCSCRLLRTICYCR-M 124 Mexican tetra
XP_005057048 106 TCKPHLNSCCHYCALCKCRIFQTICQCL-M 134 Collared flycatcher
ACC91748     100 SCKPPAPACCDPCAFCQCRFFRSACSCR-V 128 sheep
P42127        99 SCKPPAPACCDPCASCQCRFFRSACSCR-V 127 human
NP_001116411 100 SCKPPAPVCCDPCASCQCRFFRSVCTCR-V 128 rabbit
XP_003411713 101 SCKPPAPACCDPCASCQCRFFRSACSCR-V 129 African savanna elephant
XP_853932     93 SCLGHQVPCCDPCATCYCRFFNAFCYCRkL 122 dog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap