Conserved Protein Domain Family
Cytochrom_B558a

?
pfam05038: Cytochrom_B558a 
Cytochrome Cytochrome b558 alpha-subunit
Cytochrome b-245 light chain (p22-phox) is one of the key electron transfer elements of the NADPH oxidase in phagocytes.
Statistics
?
PSSM-Id: 398630
Aligned: 8 rows
Threshold Bit Score: 275.505
Threshold Setting Gi: 326927542
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q62737         9 WANEQALASGLILITGGIVATAGRFTQWYFGAYSIVAGVLICLLEYPRGKR-KKGSTMERCGQKYLTAVVKLFGPLTRNY 87  Norway rat
XP_006008327   9 WANEQALAAGIVMLIGGIVGVAGQFKNWQFAAYGIAAGVFICLLEYPRGKR-TKGTNMERPGQKYMTAVVKVFGPLTRNY 87  coelacanth
XP_005805002   9 WANEQALASGLILLAGGIVGVAGQFRGWEFAAYAVAAGVFVCLLEYPRGKR-AKGTSVERTGQYCFTVCVKAFGPLTRNY 87  southern platyfish
XP_006641301   9 WANEQALASGLILLAGGIVGVAGQFRGWEFAAYGVAAGVFVCLLEYPRGKRmSKGTNMERTGQRCLTICVKAFGPVTRNY 88  spotted gar
XP_016853551   9 WANEQALASGLILVAGGIVAVSGQFKRWEFAAYAIAAGVFICLLEYPRGKR-KKGSTMQRCGQQYFTPVVKVFGPLTRNY 87  green anole
XP_003209951   9 WANEQALAAGLIMLTGGVVAVAGQFKGWYFAAYAIAAGAFVCLLEYPRSKR-QKGSTMERCGQRYMTAVLKVFGPLTRNY 87  turkey
AAI21218       9 WANEQALASGLILLAGGIVAVAGQFKGWQFGAYGVAAGVFITLLEYPRSKR-KKGSTMERCGQKYLAAVVKLFGPLTRNY 87  tropical clawed...
XP_012395823  15 dpdsvspslstVLLTGGIVATAGQFIWWQFGAYSIVAGVFVCLLEYPRGKR-KKGFTMERCGQKYLTSVVKAFGPLTRNY 93  Tasmanian devil
Q62737        88 YVRAVLHLLLSVPAGFLLATILGTVCLAIASVIYLLAAIRGEQWTPIEPKPKERPQVGGTIKQPPTNPPPRPPAEVRKKP 167 Norway rat
XP_006008327  88 FVRAGLLAGLAVPGGFILATVLGTVCLGIASIIYLLAAFRGEQWKPIELKTVQKTRLEESITKPPMNPPPRPPADFRRKP 167 coelacanth
XP_005805002  88 YVRAFLHAAICVPGGFMLATVLGCVCLGIASLIYLAAAIRGEHWEPILPRKEVRKPVAESIKNPPQNPPPRPPPEMRRKQ 167 southern platyfish
XP_006641301  89 YVRAVLHAILSVPGGFILPTVLGCVCLGIASLIYLAAAIRGEQWEPILPQTVTKERIGQSIKQPPQNPPPRPPVDVRRKR 168 spotted gar
XP_016853551  88 YVRSILHACLAVPAGFLLATILGTVCLAIASGIYLLAATRGEEWQPIESKPKERPQVGGTIKHPPTNPPPRPPPDARKKP 167 green anole
XP_003209951  88 YIRAILHAALAVPAGFLLSTILGTVCLGIASGIYLLAAVRGEEWRPIEQKPRERPHMGDTIKQPPSNPPPRPPADARRKQ 167 turkey
AAI21218      88 YVRAILHAGLAVPGGFILSTILGTVCLGIASIIYFLAAIRGEEWRPIEKQAEPKPRAGETIKRPPENPPPRPPAEVRRKQ 167 tropical clawed...
XP_012395823  94 YIRALLHLCLAVPAGVLLATILGTVCLAIASAIYLLAAIRGEEWKPIEQKVIERAQVGTTIKQPPSNPPPRPPAEARKKQ 173 Tasmanian devil
Q62737       168 SEaeeeaASAGGPQVNPIPVTDE 190 Norway rat
XP_006008327 168 ED-----LSSGGVHVDPIPATLN 185 coelacanth
XP_005805002 168 AK-----DLESAAYDNPIPVTSD 185 southern platyfish
XP_006641301 169 TD-----DAEGAAYVNPIPVTAS 186 spotted gar
XP_016853551 168 PE------DGAGGQENPIAVEVE 184 green anole
XP_003209951 168 VV-------EVGGQVNPIPVEVe 183 turkey
AAI21218     168 ADe----VSVGGGHVNPIPVTDN 186 tropical clawed frog
XP_012395823 174 PEee-aaGPSGGPQVNPVTVTDE 195 Tasmanian devil
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap