6CDD


Conserved Protein Domain Family
zf-NPL4

?
pfam05020: zf-NPL4 
NPL4 family, putative zinc binding region
The HRD4 gene was identical to NPL4, a gene previously implicated in nuclear transport. Using a diverse set of substrates and direct ubiquitination assays, analysis revealed that HRD4/NPL4 is required for a poorly characterized step in ER-associated degradation after ubiquitination of target proteins but before their recognition by the 26S proteasome. This region of the protein contains possibly two zinc binding motifs (Bateman A pers. obs.). Npl4p physically associates with Cdc48p via Ufd1p to form a Cdc48p-Ufd1p-Npl4p complex. The Cdc48-Ufd1-Npl4 complex functions in the recognition of several polyubiquitin-tagged proteins and facilitates their presentation to the 26S proteasome for processive degradation or even more specific processing.
Statistics
?
PSSM-Id: 398613
Aligned: 76 rows
Threshold Bit Score: 218.974
Threshold Setting Gi: 0
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6CDD_A         8 VRQSPLDDRLDKLDGKIPRKRGA-MCRHGPKGMCDYCTPLDPFNPQYLEEKK--IKYMSVHAYMRKINSATNRpelgsSF 84 
EDV28357     115 VLQDEVDILLSKEDGLIHRKRHPqLCRHGPMGKCIHCSPLEPFDEEYLSKLEppIKHLSFHSYIRKLRSGVDK-----GK 189 Trichoplax adha...
XP_015791716  11 fTEDSVDIQLWTDKGLIERGKDr-LCRHGPKAKCVHCTPLEPYDEAYMKEHN--IKHMSFHSYLRKMTAGVDR-----GK 82  two-spotted spi...
XP_021203816 133 pEEDEVDLQLYKVSGLIERQRDEkLCRHNLNGKCVHCTPLEPWDEEYLKEHN--IKHMSFHSYLRKITS---------KN 201 domestic silkworm
ETN63422     137 pQEDAVDVELYKQDGRIQRKRDEkLCRHNSNGCCVHCSPVEPWDENYLKEQK--IKHFSFHSYLKKLTSGADR-----GK 209 Anopheles darlingi
XP_001951828 129 VEEDEVDKQLWKLDGKIKRLKDKkYCRHGDNGCCVHCSPLEPYDEEYLKTQN--MKHLSFHSYLRKMTAGVAK-----GK 201 pea aphid
EGI61109     140 VVENDIDEQLWKLDGKIQRKRDEkLCRHGARGCCVHCSPLEPFDEIYLKEQN--IKHLSFHSYLRKLTAGVDR-----GK 212 Panamanian leaf...
Q9VBP9       141 VIEDDVDQALSKADGTIKRERDSkLCHHNANGRCVHCSALEPYDESYLKEHN--IKHLSFHSYIRKQTSGMDQ-----GK 213 fruit fly
EFA08302     129 VKEDPVDLQLYKLDGKIERKQDPkLCRHNSNSRCVHCSALEPYDEAYLREHN--VKHLSFHAYLRKMTSGVDK-----GK 201 red flour beetle
EFX75107     121 VEEDQVDVFLQKMDGTVKRKRDPkNCLHGENSSCIHCLPLEPYDASYLKELN--VKHMSFHAYLRKLSSGLDG-----GK 193 common water flea
6CDD_A        85 IPPLVEPYYRVKRDCPSgHPQWPEGICTKCQPSAITLQPQPFRMVDHVEFASPQIIDRFLDAWRRTG 151
EDV28357     190 FTMLENVVCTITPGCKE-HPPWPNGICTKCQPNAITLNRQSYRHIDYVMFQNSKIMENFLNYWRSCG 255 Trichoplax adhaerens
XP_015791716  83 FAALDNISCKIKEGCKD-HSPWPAGICTKCQPSAITLTRQDYRHVDNIVFENAKIVERFLDYWRFTG 148 two-spotted spider mite
XP_021203816 202 FVSLEELSCKIKPGCRE-HPAWPRGICSKCQPGAVTLMRQPYRHTDNVLFEHANLVERFLSYWRATG 267 domestic silkworm
ETN63422     210 FVALEDLNCKIKTGCRD-HPPWPKGICSKCQPSAITLNRQQYRHVDNVMFENTGIVERFLNYWRTTG 275 Anopheles darlingi
XP_001951828 202 FLLLENISCRIKEGCAG-HLPWPKGICSKCQPSAITLNRQTYRHVDNIMFENSELVERFLNYWRITG 267 pea aphid
EGI61109     213 FIQLDDISCRIKTGCKD-HPPWPRGICSKCQPNSITLNRQTYRHVDNVMFENASLVERFLNYWRSTG 278 Panamanian leafcutter ant
Q9VBP9       214 YFVFDDINCRIKPGCRE-HPPWPKGICSKCQPSAITLNRQTYRHVDNVMFENTKIVERFLNYWRTTG 279 fruit fly
EFA08302     202 FLALEDISCRIKNGCKD-HPPWPKGICSKCQPNAITLNRQVYRHVDNVAFENKDLVERFLNYWRSTG 267 red flour beetle
EFX75107     194 YANLDNISCRIKPGCTG-HPPWPKGVCSKCQPKAITLNSQAYRHVDNVVFENPNLVEQFLHYWRVTG 259 common water flea
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap