Conserved Protein Domain Family
TACC

?
pfam05010: TACC 
Transforming acidic coiled-coil-containing protein (TACC)
This family contains the proteins TACC 1, 2 and 3 the genes for which are found concentrated in the centrosomes of eukaryotic and may play a conserved role in organising centrosomal microtubules. The human TACC proteins have been linked to cancer and TACC2 has been identified as a possible tumor suppressor (AZU-1). The functional homolog (Alp7) in Schizosaccharomyces pombe has been shown to be required for organisation of bipolar spindles.
Statistics
?
PSSM-Id: 398605
Aligned: 25 rows
Threshold Bit Score: 173.312
Threshold Setting Gi: 0
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_006677647  489 FSQRNLDEQRQRlqknFENEFEV--------AQLEIQD--LTLSSQNLERENQKMKDTLKQWEQAVKLMITEKDKDKQQK 558  Batrachochytr...
7_pfamImport    1 YSQKDMDAAIEK----VRLEVRE--------KELETLE--LKKKNEKLHAEYLEMGKIVAEFEGVITGMLGISQARKELL 66  
XP_016153619  729 YSQKDMDAAVEV----VKREVQE--------KELEIQK--LNEKYDKLRMDYREMGKIFDEFERTLLDFLADADQQKESL 794  Collared flyc...
XP_015199856  755 YSQKDMDAAIER----VRLEVKD--------KECEIAE--WQDKYEKLRIDYQEMGKIVSGFEATVAQIMDEGQKQKEAA 820  spotted gar
XP_007247623  804 YSQKDMDAAMER----ARKQAEE--------KEEE-----LKAQIAKMTMDNEHMVLIVSEFETIIAQITAEHKQKEELV 866  Mexican tetra
XP_005157032  737 YSQKDMDAALQK----ADRQSEE--------RQQE-----LKSQIEKLQLENQQMLFIMSEFETTITQITDEHKQKEALA 799  zebrafish
EFN83265      794 EKQKKHEVDLEK----QKAT-----------FQEKINK--LQAQVAQEVKMKTQMSVVVEEYEKSISRLLTERERDRTNF 856  Jerdon's jump...
Q95TU9       1089 HNYNDMDELEKK----IKNEVTRsediekklKEGELREeaLIKRITEKDKTNAKLNGVIEAYEKAIAELISEKEQQAQLH 1164 fruit fly
6_pfamImport    1 YDNLD---AINP----FQGSNMI----------------------------------LLSPAKPVVDHPPENIQEEPNVE 39  
NP_001011729  676 YSQKDMDAAIAK----VQAEVEK---------DNC-----WSAKYKKLLEDGQEMRKIIAEFESMIAQMMADQEKQTEES 737  torafugu
XP_006677647  559 QAEIDRLK----EQLDLAYAERNESKKELDQMSLKYKQLRVD---ISDLKELDERQREQISELEQTVATGNQRFDSLRAH 631  Batrachochytr...
7_pfamImport   67 RGNLMYNLflrtQEKKEVKLNL---QKSPSELFSRWLRQVSTslfFSFFKNNEEALKKCVQDYLARIKKEEGRYQALKAH 143 
XP_016153619  795 RKDIQKLM----EEKQQALSDLNSMEKAFSDLFKRFEKQKDA---LVGYHKNEEVLKKCAEDFWARIKKEEQRYQALKAH 867  Collared flyc...
XP_015199856  821 SLEIEKAL----QEKQQVLLDLNSMEKSFSDLFKRFEKQKVV---IEGYRKNEETLKKCAQDYLARIKKEEQRYQTLKAH 893  spotted gar
XP_007247623  867 QAELSKVF----QEKQQLAKDLNDMERSFSDVVKRLDRRKEV---IDGFKKNEETLKQCAQSYLARLQKEEQRYQMLKTH 939  Mexican tetra
XP_005157032  800 KMEMERVL----EEKDQLAKDLNELERSFSSVVKRLDRCKEV---IEGFKKNEETLKQYAKNCMDRLQKEEKRYQALKAH 872  zebrafish
EFN83265      857 EQEKAKLQ----EELQAANHHLTNTEAAFNDVHQKYERLKGV---VSVYKNNEAVLKESIQENVDTIKTLETRYDQLKDH 929  Jerdon's jump...
Q95TU9       1165 ERQLQEVQ----ADRDANYHHLTSLETTFSDLHVKYEKSKEM---TSQLKSNEESLLAERKQMMDNLRLQEQRYDKMKNH 1237 fruit fly
6_pfamImport   40 DLRQDDTL----PFIPSVDNSLADVNISSTDSSVVIVTMNET---VEG-QDNEEILKTRAQDYQERIKKEEQRYQILKAH 111 
NP_001011729  738 QKQLNEAL----SEKEQVASDLNAMERSFSDLFKRLEKYKEV---VQGYKKNEETLKACAQDYLARIKKEEQRYQALKAH 810  torafugu
XP_006677647  632 AETKLDEANVEIARVRASYEKEAAAMRAKLSRVEIQMQTLDCNLKTKVQENQELTKICDDLV 693  Batrachochytrium dendrobatidis ...
7_pfamImport  144 AEEKLHQANEEIAQVRSRFKAESVALQASLRKEQMKVQSLERSLEQKAKENDELTKICDDLI 205 
XP_016153619  868 AEEKLEQTNETIAQVRSKADAETAALQATLRKEQMRIQSLERSLEQKTKEIDELTKICDDLI 929  Collared flycatcher
XP_015199856  894 AEEKIGLANEEIAQVRLKLKAETAALQAQLRREQVKIQSLERSLEQKEKENEELTKLCDELI 955  spotted gar
XP_007247623  940 AEEKIEQANKEIADVRSKLGTEISALQVQLRREQLKVQSLEKNLEQKVKEVEDVTKLCDELI 1001 Mexican tetra
XP_005157032  873 AEEKLEQANKAIAEVRTKQGAEVAALQVQLKREQLKVQSLEKDLEQKAKEVKDVTELCDELL 934  zebrafish
EFN83265      930 AMAQLEKANLELDGIRKQNEAETVKLHAMIRKAELKSNSLAELVEQKTKENKELAKILDEVI 991  Jerdon's jumping ant
Q95TU9       1238 AMQQLEIANKKLDTYSREHADETKKLKALLKKEEISRVSMTEQLQQKSRENADLLKICEELI 1299 fruit fly
6_pfamImport  112 AEGKIGQANEEIAEVRSKYKAEFSALQAQLRREQLKVQSVEKRLDQKEKEAQELTKLCDDLI 173 
NP_001011729  811 AEEKIAQANGEIAEVRSKNKAELSALQAQLRREQLKAQSLEKSLDQKGKEAEELTKLCDELI 872  torafugu
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap