3H0G,4V1M,4XLN,5N5Z,6EU2,3HKZ


Conserved Protein Domain Family
RNA_pol_Rpb1_4

?
pfam05000: RNA_pol_Rpb1_4 
Click on image for an interactive view with Cn3D
RNA polymerase Rpb1, domain 4
RNA polymerases catalyze the DNA dependent polymerization of RNA. Prokaryotes contain a single RNA polymerase compared to three in eukaryotes (not including mitochondrial. and chloroplast polymerases). This domain, domain 4, represents the funnel domain. The funnel contain the binding site for some elongation factors.
Statistics
?
PSSM-Id: 398598
Aligned: 106 rows
Threshold Bit Score: 54.6778
Threshold Setting Gi: 75335311
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3H0G_M  700 IQDAQH-NRLKPEPGMTLRESFE---AKVSRILNQARDNAGRSAEHSLKdsNNVKQMVAAGSKGSFINISQMSACVGQQI 775  Schizosaccharomyces...
Q9MW07   91 VHAAEKlRQLIETWYATSEYSKQ---EMNPNFRM--TDPl-----------NPVHMMSFSGARGSASQVYQLVGMRGLVS 154  Anthoceros punctatus
Q85FM9   91 LHAIEKlRQSIEAWYATSECLKR---EMSPSFKM--IDPl-----------NPVHMMSVSGARGTISQVHQLLGMRGLMA 154  Adiantum capillus-v...
Q9BBS7   91 VHAVEKlRQSIEIWYATSEYLRQ---EMNPNFSM--TDPf-----------NPVHIMSFSGARGNASQVHQLVGMRGLMS 154  Lotus japonicus
P58132   90 INLITYlIKEKRTWDNMNENLKI---ESIKNLKQ--NDLl-----------NSLYTMTLSGARGNINQVKQLISMRGLIS 153  Euglena longa
P23581   90 INFINVlDEERDIWNVVNENLKK---ESINNLRQ--SDFl-----------NPLYSMTLSGARGSITQVKQLIGMRGLMS 153  Euglena gracilis
O57204  610 LNDVRDgKIVPLSKALEADYVESmlsNLTNLNIREIEEHMRQTLIDDPD--NNLLKMAKAGYKVNPTELMYILGTYGQQR 687  Vaccinia virus Ankara
Q9J593  611 LYDVANgDIIPLSRSDEMDAVDSilsGLTNFNIQEIEKYMKEVISKDPD--NSLMKMSCAGYKVNPTELMYILGTYGQQR 688  Fowlpox virus strai...
Q85289  610 LADVASgAVLPLSPGDEAEAVDAmlsGLTNMNVREIEAYMRRTLREDPD--NSLLRMSCAGYKVNPTELMYILGTYGQQR 687  Molluscum contagios...
Q9EMI5  623 LQYYIKk---DHIIKLTYDEMENiriQNGNNIISNVKNKINNLFKDEKL--NTIMMMKNSGYKITLDELVTVLGCTGQQG 697  Amsacta moorei ento...
3H0G_M  776 VEGKRIPFG-FKYRTLPHFPKDDDSPESRGFI 806  Schizosaccharomyces pombe 972h-
Q9MW07  155 DF---------------QGQ-IIDLLIKSNFR 170  Anthoceros punctatus
Q85FM9  155 DP---------------RGQ-VIDLPIRRNLR 170  Adiantum capillus-veneris
Q9BBS7  155 DP---------------QGQ-MIDLPIQSNLR 170  Lotus japonicus
P58132  154 DS---------------QGN-LLNLPIKTNFK 169  Euglena longa
P23581  154 DS---------------QGN-VIPFPIKTNFK 169  Euglena gracilis
O57204  688 IDG-EPAETrVLGRVLPYYLPDSKDPEGRGYI 718  Vaccinia virus Ankara
Q9J593  689 IDG-EPIDTkIYGRVLPYFLPDSKDPEGKGYI 719  Fowlpox virus strain NVSL
Q85289  688 VDG-EAVEPrVLGRVLPYFPPDSRDPEGRGYI 718  Molluscum contagiosum virus subtype 1
Q9EMI5  698 IDSDDIPKPgIMGRVFDSTLPGSLDIESLGYV 729  Amsacta moorei entomopoxvirus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap