Conserved Protein Domain Family
CmcI

?
pfam04989: CmcI 
Cephalosporin hydroxylase
Members of this family are about 220 amino acids long. The CmcI protein is presumed to represent the cephalosporin-7--hydroxylase. However this has not been experimentally verified.
Statistics
?
PSSM-Id: 398587
Aligned: 13 rows
Threshold Bit Score: 290.823
Threshold Setting Gi: 489253745
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
tigr:AHA_4161  38 KKYSYHFRWAGRPIIQYPQDIVAMQEIIFDVKPDLIIETGIAHGGSIIFSAAMLAQLdlfeaiesgstidprHSKRKVIG 117 Aeromonas hydr...
jgi:Acry_0597  35 CQYSYNFHWLGRPIIQYPTDVIAMQELIWEVKPDLIVECGIAHGGSLIFSASMLALLdmceaieageplepaVSRRKVLG 114 Acidiphilium c...
jgi:Veis_4414  38 RRYVYNFDWLGRPIIQYPQDMVALQALVWRLRPDLIIETGIAHGGSLVLSASLLALLdlsdaieagdmldprASRRKVLG 117 Verminephrobac...
WP_012175381   39 PGYSYNFDWLGRPIIQYPQDMAAMQELIWKVKPDLILETGIAHGGSLIFSASMLALLeycdaaekgelldpgNPIRRVLG 118 Desulfococcus ...
Q31S83         40 tKYAYHFSWINRPIVQLPQDIVAFQEIVSSVQPDIIIETGVAHGGSLALSASLLCLLdvmeg------lnprQSSRKVIG 113 Synechococcus ...
jgi:Plav_3346  42 QKYSYSFSWLGVPIIQLPEDMIRFQEAIFELKPDVIIETGVAHGGSAIFSASLCHLL----------------GHGRVVA 105 Parvibaculum l...
Q1D436         20 EYHGGGERWMGVPIRKVPHDLWIYQEILHETRPDLIIETGTMFGGSALYFAHLCDLL----------------GHGQVIS 83  Myxococcus xan...
WP_003161750   19 rvWLYDTHWLGVPILKLPSDLFLYQEMIYELKPDLIIECGTCYGGSALYLASILDLI----------------GKGHVLT 82  Bacillus
Q5P6Q3         26 NGVWETVRFLGVPCLKSVMDLWNYQEILFELKPSLIVEFGTRHGGSALYFSMIGQGI---------------NPLLRVLT 90  Aromatoleum ar...
Q9CD89         33 NFVWNTTTWMGIKCLKSVSDMWNYQEILIELEPSLVIEFGSRFGGSALFFANVMMHI---------------GQPFKVLS 97  Mycobacterium ...
P9WIM5         48 nlVWTKTTYMGINCWKSVSDMWNYQEILSELQPSLVIEFGTRYGGSAVYFANIMRQI---------------GQPFKVLT 112 Mycobacterium ...
P72897         38 NGYTYNYSWLGRPIIQYPQDIMAMQELIWSIQPDLIIETGIAHGGSLIFSASMLELNais----------ggPQDAEVLG 107 Synechocystis ...
Q15RC7         38 DNYTYNFSWLGRPIIQVPQDIVAMQELIWEIKPDLIIETGIAHGGSIIFSASMLAQLdmceaiqsgqtidpkKSKRKVLA 117 Pseudoalteromo...
tigr:AHA_4161 118 IDIDIREHNRVQIESHPLSSRIQMLQGSSVDAEVIKKVYEIAAG-YEKVLLCLDSNHTHDHVLAELEAYAGLVSVGSYCV 196 Aeromonas hydr...
jgi:Acry_0597 115 IDIDIRAHNRTAIDAHPMRSRIEMIEGSSISADVIAEVGRIASA-HRNVLVCLDSNHTHDHVYAELEAYASLVSVGSYCV 193 Acidiphilium c...
jgi:Veis_4414 118 VDIDIRAHNRAAIEAHPMASRIAMIEGSSLAPEVVQQVRAFAQG-YRRVLLCLDSMHTHEHVLGELNAYAPLVTPGSYCV 196 Verminephrobac...
WP_012175381  119 IDIDIREHNRAAIEAHPMAGRIQMIQGSSVDAEVIQKVHAVAKE-FSRILVCLDSMHTHDHVLAELEAYAPLVSPGSYCM 197 Desulfococcus ...
Q31S83        114 VDIEIRPHNRKALDEHPLRFKMELIEGSSIDPKIIQQVKSHVQS-SERVLVSLDSNHTHEHVMAELNAYASLVTAGSYCI 192 Synechococcus ...
jgi:Plav_3346 106 VDIEIRPKNRQRIEAHPFAHLITLIEGSSTAPEIVEQVRSHIKP-GDKVVVVLDSDHSYKHVTDELAAYAPMVSEGSWII 184 Parvibaculum l...
Q1D436         84 IDLDQRES-------VPRHHRIEYMQGSSVAPEILERVRGRIAP-GTRTMVVLDSDHSAEHVLQELRLYSPLVSPGHYLI 155 Myxococcus xan...
WP_003161750   83 IDI-FPQPNR------PSHDRITYLTASSVSVTAVQTILSMRKP-DDVILVILDSDHSKEHVAKELLLYKSIVTKGSYII 154 Bacillus
Q5P6Q3         91 VDIEDHLLDPQVSRV----PAIEFMKCSSTDSAVAARITELRNSlPGPMFAILDSDHHQPHVLQEMLSLRSVMRSGDYLV 166 Aromatoleum ar...
Q9CD89         98 VDISHKDLDPAARQ-----PDILFIESPSTAPAIAEQIRRLKNEyPGKIFAILDSDHSMKQVLAEMKLLQPLLTAGDYLV 172 Mycobacterium ...
P9WIM5        113 VDNSHKALDPRARRE----PDVLFVESSSTDPAIAEQIQRLKNEyPGKIFAILDSDHSMNHVLAEMKLLRPLLSAGDYLV 188 Mycobacterium ...
P72897        108 IDIDIRQHNREAIEAHPMVKRISMIQGSSIAPEIIEQVKAKAEG-KQKILVCLDSNHTHDHVLAELEAYAPLTSVGSYCV 186 Synechocystis ...
Q15RC7        118 IDIDIREHNRDAIECHPMASRIEMIQGSSIDPDIVNTVKTFAKQ-YSRIMVCLDSNHTHEHVLAELEAYANLTSVGSYCV 196 Pseudoalteromo...
tigr:AHA_4161 197 VFDTIVEDLPESLSSDRPWGPGNNPKTAVHSFLAKDTR-FVVDE---FIENKLM---ITVAPDGYLKRI 258 Aeromonas hydrophila subs...
jgi:Acry_0597 194 VFDTLIEDMEPDAYPDRPWGVGNNPKTAVHAYLKNHPE-FQIDK---LIPDKLM---ITVAHDGWLRRT 255 Acidiphilium cryptum JF-5
jgi:Veis_4414 197 VFDTFIEDLPPRFFPDRPWDRGNNPKTAVRQWLAGQTD-FEIDA---EMEQRLQ---LTAAPQGFLRRM 258 Verminephrobacter eisenia...
WP_012175381  198 VFDTIVEDLPEDFFSNRPWAKGNNPKTAVHEFLKTHRE-FEIDK---EIEHKLL---ITVAPDGYLKRV 259 Desulfococcus oleovorans
Q31S83        193 VFDTVIEDLPAGSFPDRAWDVGNNPKTAVHEWLKSHPE-FAIDK---DIDNKLL---ISVAPDGYLKRI 254 Synechococcus elongatus P...
jgi:Plav_3346 185 ATDGVMQDLPDVPRGQPGWDK-DNPAAAARDFVAANPG-FVLETpawPFNESTLsdnITHWPDAWVRRA 251 Parvibaculum lavamentivor...
Q1D436        156 VEDTNIGHPLHT------FQVERGPMEAIEAFLPTAPD-FERDS----SREKLL---FTSNPGGFLKRI 210 Myxococcus xanthus DK 1622
WP_003161750  155 VEDTSINGNPVS----PDWGPG--PMEAVEEFLATNNN-FIIDE----SKHKFF---ISFNPKGFLKKI 209 Bacillus
Q5P6Q3        167 VEDSNINGHPVL----PGWGPG--PFEAIAEYVRQFPDdYVRDE---ARECKFG---FTFAPAGFLRRA 223 Aromatoleum aromaticum EbN1
Q9CD89        173 VEDSNLNGHPVL----PRFGAG--PYEAIEAYEREFPGdYEHDV---AREKKFG---FTFATNGFLIRK 229 Mycobacterium leprae TN
P9WIM5        189 VEDSNINGHPVL----PGFGPG--PYEAIEAYEDEFPNdYKHDA---ERENKFG---WTSAPNGFLIRn 245 Mycobacterium tuberculosi...
P72897        187 VFDTVVEDLPDEMFGDRPWGVGNNPKTAVWEYLKTHPE-FEIDK---SIQHKLL---ITVAPDGYLKRL 248 Synechocystis sp. PCC 6803
Q15RC7        197 VFDTVIDDMPENMFPNRPWGPGNNPKTAVWEYLKSHPE-FEIDK---SIHDKLL---ITVAPDGFLKRT 258 Pseudoalteromonas atlanti...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap