Conserved Protein Domain Family
NMD3

?
pfam04981: NMD3 
NMD3 family
The NMD3 protein is involved in nonsense mediated mRNA decay. This amino terminal region contains four conserved CXXC motifs that could be metal binding. NMD3 is involved in export of the 60S ribosomal subunit is mediated by the adapter protein Nmd3p in a Crm1p-dependent pathway.
Statistics
?
PSSM-Id: 398579
Aligned: 184 rows
Threshold Bit Score: 134.345
Threshold Setting Gi: 123978787
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q5JGP6             6 CYRCGISEregGpLiEgLCQVCYRKE-NPVLLIENE-In---TELCQNCGSYKKRgVWVDp-hS-YELEELIFEVAENAl 78  Thermococcu...
CBRAS:TCELL_0394   4 CLNCGREVs-dEdYvNgYCIDCFRKIgNPFTK--QVsLe---LKVCSRCGSIFYKgEW---------HQDSMENIVRRYl 68  Thermogladi...
WP_011839391       5 CVRCGRRVsedEpLiNgYCIDCYLKY-KGIFVTKPV-Ln---ITICPRCGSWMYRgEWRDp--L--PLREIIRRILISEa 75  Staphylothe...
jgi:Tagg_0968      4 CVRCGKEVs-dEeIvGnYCVDCYVKH-LTPFKDKPR-Le---VMVCPKCGAWFYKgEWNHp--L--EENEVLRRIAIWGs 73  Thermosphae...
CBRAS:DKAM_1085    7 CVKCGREFk-qEdLiNsLCVNCYLKY-HGVFKETPH-Ve---LTICPKCGSWYFKgAWHPs--L--DIREVIRRELLADl 76  Desulfuroco...
CBRAS:FFONT_0821   5 CPICGREEsknLpFvGgICVECYLNK-N------PLeIkaitLNKCKICGKIRYKnDWi------FANENFYSEIFAKEv 71  Fervidicocc...
imbp:Hbut_1236    10 CARCGKPLt-pGdSvGpFCLDCYVEM-FKLLCVPER-Vr---FDYCKYCGAYRIGhRWQSggeLeEAVQRFVEEVAGGV- 82  Hyperthermu...
jgi:Pyrfu_1371     9 CIRCGRRIaasEpViDgMCLECFLEE-RKLVEIPGR-Ld---FEYCRSCGAIRYGyRWVEqlpLeEASRRYLELYLSERv 83  Pyrolobus f...
WP_011838704       5 CIYCGAEDtpdNpVvEgVCLRCRIKR-GEIIEQVKReIr---VDFCKVCGAVRIGyKWIDtngFnEALHHIVYNQLKELv 80  Staphylothe...
Q9Y9F4             7 CASCGRGS---EvLlRgLCPECFDRR-YGVVEGLPWeLv---VDVCTSCGRVRIGhKWLEyatAeEAVGLMLSSMSLKPv 79  Aeropyrum p...
Q5JGP6            79 -----lEALEdsfs---dkirEY-E-VVSP---EEL-EETEEIpvgraivsfepvdyhieyfpaiityEVRVKARThelq 144 Thermococcu...
CBRAS:TCELL_0394  69 --------Ldnqak---ymiaSA-ElISVEpsgEPReSAK----------------------------GVYVQNWLfg-i 107 Thermogladi...
WP_011839391      76 -----yRFIdrqh----vnllDA-TiLSEPykiNES-QYAVKA-------------------------LLHVVIE----- 114 Staphylothe...
jgi:Tagg_0968     74 -----kRFLreev-----evlDV-SvVKSLhkiSASeHGV----------------------------TLNYQLLIk--- 111 Thermosphae...
CBRAS:DKAM_1085   77 -----hRFLyeni-----sviEV-DvVSDIykiNAG-EYGVKA-------------------------IFTMEVD----- 114 Desulfuroco...
CBRAS:FFONT_0821  72 eknnkkKFIQfgld---lkavPY-KeKVLVtvqNEIgKYET--------------------------------------- 108 Fervidicocc...
imbp:Hbut_1236    83 ---------KpcrpevrgfsvEGvEpLTKPswrTIY--------------------------------AIRYSIQVq--- 118 Hyperthermu...
jgi:Pyrfu_1371    84 ---------KpahalvedvkiVNiEpLQYPswrSVY--------------------------------RVVVEARLk--- 119 Pyrolobus f...
WP_011838704      81 kpgigvDDLr----------iDGyElVTSA-------SWRTVV-------------------------RVYFRGIYggk- 117 Staphylothe...
Q9Y9F4            80 ------------------------HpVERVeleDWAlETRLDW-------------------------RTRVRLRFr--- 107 Aeropyrum p...
Q5JGP6           145 rElHD----ERKKVTVYVRQ------TVCPRCQKFLGGYFEAILQVRAEdrplteEERKAIGKLVEEKVdeimRK-D-RM 212 Thermococcu...
CBRAS:TCELL_0394 108 vLnKKhfvqFNQDVRISVSR------TICPRCLARASRKISAVVQVRGV-------NAQAHRGLVEGVI----MSnPgYS 170 Thermogladi...
WP_011839391     115 ---EYyplnLEKEIVLNINR------KVCPKCLAYAGKSHRALVQIRSVngsfsrEEEKIINKAISDPG---------VA 176 Staphylothe...
jgi:Tagg_0968    112 ---gIhpvnFELEVPVRITY------KPCPSCLARAGGSHKALVQVRVEgevdieELAEEVEELLVKAG---------LS 173 Thermosphae...
CBRAS:DKAM_1085  115 ---GRhvvkVNQVVITKLRY------RTCDKCMRRTTGSHKVLVQVRFEplenieGLRHEVMELLRDLE---------IG 176 Desulfuroco...
CBRAS:FFONT_0821 109 ----------------YLDPiidykfTICPQCLARKAGSYDSVIQIRGTnkl-dfEDKKIIMNLIEKLPy------D-LK 164 Fervidicocc...
imbp:Hbut_1236   119 --gVDkpisQTYRVEVRASP------TICPTCKDVRGGEYNVLLQVRGI-------KPAELARLLGPLL----DSsEqIQ 179 Hyperthermu...
jgi:Pyrfu_1371   120 --gVEepvrQEYVVEVRAVP------SLCPACKNDRGGDYNVLVQVRGR-------IDAKLVEVLGRIL-----DsGrVA 179 Pyrolobus f...
WP_011838704     118 ------efvYPLDFIVYLNP------TKCPRCKMIESGEFEAVVQIRDV-------HVKDLEKALEKIF----SRdKrLR 174 Staphylothe...
Q9Y9F4           108 aNyRDtlfrVSRVIVLRLNP------STCPLCIVRRSGEYDTLVQVRGY----------RAGEAVEKTL----NSlD-PR 166 Aeropyrum p...
Q5JGP6           213 GFIQDTIEKEEGLDFYMGSTSAARKLAQAIKERFGGKI-SEAYELVGMDRQTSREVYRTSVSVRI 276 Thermococcus kodakarensis ...
CBRAS:TCELL_0394 171 EYLVDVEDAPNGFDIRFVDQLPARRLAYELARLLGGHV-KETFKSTRYDARKGVWQGIHTFSVRL 234 Thermogladius calderae 1633
WP_011839391     177 GDIVEIKKNKYGLDVKLLTSVAAKRLSTILSRLTGAKI-IESFKPVRYNPDKGRWSGITTLSVRL 240 Staphylothermus marinus
jgi:Tagg_0968    174 SSVTEVEVVKEGVDVKFEDPVAARKLSSILSRKYGAST-AESFRSTRFDAHEGKWRGVVTLSVRI 237 Thermosphaera aggregans DS...
CBRAS:DKAM_1085  177 ESIIEVMELREGLDIKFEDIVSPRKYVNILVKKYGAKT-SESFKSTKYDFQEGKWSGVMTISVRI 240 Desulfurococcus amylolytic...
CBRAS:FFONT_0821 165 QHIVTITENKDWIDVEIVGHEKARLIASFLSEKLGGET-KQTFKLIST-KK-GERNSRLTISLRI 226 Fervidicoccus fontis Kam940
imbp:Hbut_1236   180 NSIVDIVEYNNGVDFLLLDRGSAAKIIKEIKKKYIVVT-RTTGEDVGITST-GHMRRRTVIAVRV 242 Hyperthermus butylicus DSM...
jgi:Pyrfu_1371   180 PWVVDIIEDKRGIDILLRDRGAASRIVSELSKYFVVDV-KRSAETVGMTST-GIERRRLTISVRV 242 Pyrolobus fumarii 1A
WP_011838704     175 QDLVDYIEVKNGIDIYFYNHGAARKLSRKLSNMLGLVI-KENYEVAGM-RS-GKQRARLYVSLKp 236 Staphylothermus marinus
Q9Y9F4           167 EAPIDVVPVRGGVDVYFHHRGAAARFVSRLASTARVRVsRVEHEHVGTSSL-GRRRSRKTILVRL 230 Aeropyrum pernix
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap