Conserved Protein Domain Family
Phage_holin_2_1

?
pfam04971: Phage_holin_2_1 
Bacteriophage P21 holin S
Phage_holin_2_1 is a family of small hydrophobic holin proteins with one or more transmembrane domains. Members of this family fall into the holin superfamily II, and Phage 21 S holin is the prototype for this superfamily. It has two transmembrane segments with both the N- and C-termini on the cytoplasmic side of the inner membrane in E. coli. Holins are a diverse family of proteins that cause bacterial membrane lysis during late-protein synthesis. It is thought that the temporal precision of holin-mediated lysis may occur through the build up of a holin oligomer which causes the lysis.
Statistics
?
PSSM-Id: 398572
Aligned: 9 rows
Threshold Bit Score: 63.2331
Threshold Setting Gi: 1055847568
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q32F12        5 DKISTGIAYGTSAGSAGYWFLQWLEQVSPSQWAAIGVLGSLLLGLLTYLTNLYFKIREDKRKAA 68  Shigella dysenteriae Sd197
KQN56739      5 DKLTTGLAYGSSAGSTGFWVLQLMDQVTPSQWAAIGVLGSLGFGLLTYLTNLYFKIKEDRRKAA 68  Erwinia sp. Leaf53
Q2NSB8        5 SDVAAGLSYGTSLGSGGYWLLQLMDTVSPGQWSAIGVLASVFFGLLTYLTNLYFKIKDYRRKRH 68  Sodalis glossinidius str. 'morsi...
WP_025796664  5 DKITTGISYGASGGSALFWLKQLLDGFSPEQWAAFGVLGSLLFGFLTFLTNLYFKVKEDRRKAS 68  Hafnia alvei
WP_067431676  6 SKLASGAAYGASAGTI---ANGLLTCLSPDEWSAVGVLAGIVVALITLGINWYYKRKATLAQIK 66  Erwinia gerundensis
WP_042395855  5 SKLVTGVALGTSGGTI---LNGVLTKLSPDEWSAVGVLAGIAGIIITGLVNWYFKRKVTNAQVK 65  Pseudescherichia vulneris
EGG93491      3 EKIAVTTSYGASATSI-------VAGLSSAEWSVVGIVGGLIIGVATFFVNLWFKLEQLKIDRE 59  gamma proteobacterium IMCC1989
WP_118859779  5 DKIFSAASYCTSGGLICTGLAQTYDWFHGLDWNFIALASGVVIGVATYLTNLYYKRRWTKMYQQ 68  Enterobacteriaceae
KMV69644      5 GKISSVVSYCASGSLICWG--SVMDKIHHLDWQTISVVGGLVIGVITCASNFYFKRRQTRAYES 66  bacteria symbiont BFo2 of Frankl...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap