1O5H


Conserved Protein Domain Family
FTCD_C

?
pfam04961: FTCD_C 
Click on image for an interactive view with Cn3D
Formiminotransferase-cyclodeaminase
Members of this family are thought to be Formiminotransferase- cyclodeaminase enzymes EC:4.3.1.4. This domain is found in the C-terminus of the bifunctional animal members of the family.
Statistics
?
PSSM-Id: 398564
Aligned: 242 rows
Threshold Bit Score: 67.8992
Threshold Setting Gi: 502635245
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1O5H_B          20 LKEFCDXVAE-RKPTPGGGAVGSVVGAXACALAEXVANFTRKKKGYE-D-VEP----E-XERIVEAX-EEAR---LKLFD 87  Thermotoga ma...
WP_015326902    33 IKELSQQIASpKNPVPAGGATIATTALLGVSLLKLVFQVSQNNWNIK---TKE----E-FNEYLTTL-NTIQ---EDLSQ 100 Halobacteroid...
jgi:Desti_2350   2 kdAFLEALSR-PRPDPGGGAASAYGALLSVAIVEKIVRIELQRNENSgS-----------ESVLTRMlSTVVvlqKDCAQ 69  Desulfomonile...
jgi:AciX8_1968  14 LAEMRDLIAS-VKPTPGGGSVSVVSAVFGLALISKGIAISLRHVDTDsP----------RQQILLEAkNSLGismKRLGA 82  Granulicella ...
jgi:Deima_0623  29 ayvlLARTAS-SSPTPGGGSMSAMAGAYGLALVVMGLEISAAREDAHpD----------LPAVLADArTHLL----NVLR 93  Deinococcus m...
jgi:Nther_2329   8 IDQYLELISA-DNETAAGGSTLAVSAAMGSHLVIMYCNISMGKKSIRkN-SAN-------YYLLEECrEKAKilgDDFRR 78  Natranaerobiu...
WP_013049277     9 VNDLVEQISL-GTPSPGGGSVAALCGAMAAALGGLVARLTLSKEAYEqS-WKV------MEQVRDQT-RALS---DRFLY 76  Aminobacteriu...
JLU:CLAU_1683    7 INSFLENIAS-KPLTPAAGSIAALSAASAAALTEMAANLTSKKPKYH-DiSAK------MKEIAEEC-SSYR---EIFLN 74  Clostridium a...
Q250X3           1 ----mEKVAS-LPSTPAGGSVAALNAASAAALAEMASRLTADK-------MEDgalaKeLKGMAEVF-HSYR---VKFTD 64  Desulfitobact...
jgi:Clos_0403    8 IDEFLEDIAT-KPCTPAGGCVAALCAASSSALMEMVARHTLRNKEASsE-VVD----F-MEEVVHIA-ASTR---KNFLA 76  Alkaliphilus ...
1O5H_B          88 LAKKDXEAFEKVXKAYK----------SSEGELQNALKEAASVPXDVIRVXKDLAHELEKLAEFGNKNLASDTLNAADLC 157 Thermotoga ma...
WP_015326902   101 AIADDTKAY-QINLANNfq-------------nQTKLKKIIAVPLQITETAKAALTVGDKLEGKVKTTVQADHKVATLNL 166 Halobacteroid...
jgi:Desti_2350  70 WCEQDVQAYLELARVRKag--------iTGSELISSMESAVECPLNIMQSGLRILKCIADVGSLCRKHLISDLQVAAEFA 141 Desulfomonile...
jgi:AciX8_1968  83 FADADANTFQTYLRARAmphitedetqARALAMNTALLDAIRIPLEAAREMCTCMAVADTATKLSDDRVLSDVVAGALLL 162 Granulicella ...
jgi:Deima_0623  94 HPDADVRAFEGYIHALHlprgtaeekaARTAARADAARYAIRAPLSSARDLNAALDLAVHAAPLAHRHVVSDVGAGAHLI 173 Deinococcus m...
jgi:Nther_2329  79 FIERDVEVVKRYFEHRD----------------EDTAKELTLIPFMTAQRAKELLRVIEKVKGQGYNPLEPDLMAGAHHA 142 Natranaerobiu...
WP_013049277    77 LMEEDTNAYLSFLETANlpsevpeeeeIKGILREQMMKKAIVVPLEVLRCCKDAMPLLRSASALGVRVAVNDAMAGLSVL 156 Aminobacteriu...
JLU:CLAU_1683   75 DIDKDTKAFKKVIDLYLmplntesekeIQQKELQNSFKTAIEIPLSMANNIVELIYAIRFVNKHGCKTSASDVKQAYILA 154 Clostridium a...
Q250X3          65 AIDEDAKVFSEVLSAYKlaadsaenrkIRDEKIQESYKKAVIVPIKLAEDIWAMMQLIKMQHHHIGDSYITDSAQAYMLA 144 Desulfitobact...
jgi:Clos_0403   77 YMDKDTEAYMKVIDAk-----------DQEGPMEEYHKDSVRVPFEMAREIFRMIDLIRKTTQDGSEILVTDGVAALLMA 145 Alkaliphilus ...
1O5H_B         158 HAVFQVEKVNVLINLKEIS-DETFRKNXLEELEE 190 Thermotoga maritima
WP_015326902   167 KASIKGAITIIEANYNFFPaDDNYIKKVKSKINK 200 Halobacteroides halobius
jgi:Desti_2350 142 RAAIYGASHITSANLLLMR-ERGHVSSYEQRFQT 174 Desulfomonile tiedjei DSM 6799
jgi:AciX8_1968 163 RASISSVLLNVDINLVHLS-DSALREHLHSQRVQ 195 Granulicella mallensis MP5ACTX8
jgi:Deima_0623 174 HGAIHATLLNVDINVGSLP-EEERASAREERDev 206 Deinococcus maricopensis DSM 21211
jgi:Nther_2329 143 QNALYGSLINVHQNLDLIK-DKNFYRMIKVEAAN 175 Natranaerobius thermophilus JW/NM-WN-LF
WP_013049277   157 RAAAVASCFTVMTNLPTLY-DEEFCSSVKDEALs 189 Aminobacterium colombiense
JLU:CLAU_1683  155 ESAVRSSIFLIKSNLVFVH-DEDFQTYISKKIDE 187 Clostridium autoethanogenum DSM 10061
Q250X3         145 EAALKSLLYHIKSNLMYIR-DKEFTEKIEEVLEQ 177 Desulfitobacterium hafniense Y51
jgi:Clos_0403  146 KVTLNTLVYHIKFNLNYVK-DKKFAEHILAQLSL 178 Alkaliphilus oremlandii OhILAs
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap