1YLE


Conserved Protein Domain Family
AstA

?
pfam04958: AstA 
Arginine N-succinyltransferase beta subunit
Arginine N-succinyltransferase EC:2.3.1.109 catalyzes the transfer of succinyl-CoA to arginine to produce succinyl-arginine. This is the first step in arginine catabolism by the arginine succinyltransferase pathway.
Statistics
?
PSSM-Id: 398561
Aligned: 89 rows
Threshold Bit Score: 362.974
Threshold Setting Gi: 501191255
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1YLE_A             5 VXRPAQAADLPQVQRLAAD--SPVGVTSLPDDAERLRDKILASEASFAAEV-SYNGEES---YFFVLEd---sASGELVG 75 
WP_014437136       8 TVRGVREQDVPALLALAET--AGQAFTSLPADGSFIAARVEASRRGEAP--------------LMAMEd----PSGAVVG 67  Phycisphaer...
Q6MRF7             4 IIRPVHHDDLNQLVDLAKQfnL----LNLPGDKKVIGEKIDRSEQSFAGKLsKTQSE-----YLFVLEd---vEEKYVVG 71  Bdellovibri...
CBW28112           3 NLRPAKLSDIEDLFALSQHyvF----ISLPSDKELITKKVKSSISAFKKAS-KDISEDT---YIFVLEd---lSKSKVIG 71  Halobacteri...
Q1CYE6             3 VLRDVQKTDLPGLKRLAAVlnT----VNLPNNEETLSAIVDTSVKSFAGKV-KNPFERE---YLFVLEd---vRNSLIIG 71  Myxococcus ...
Q2IMC6             3 LLRDAQKTDLAGLSALAKVlnT----VNLPDDERALSGIVDRSVRSFAGKI-RNPLERA---YVFVAEe---pRTRRIVG 71  Anaeromyxob...
jgi:Anae109_0195   3 LLRDAQKSDLPSLSRLAKVlnT----VNLPYDERALARIIEQSVRSFAGRI-RDPLQRA---YVFVAEe---pRSGRIIG 71  Anaeromyxob...
jgi:Hoch_4839      3 RIRESTAEDLDQIFSIAKHldT----VNLPADRGELEKLLALSESAFAGV--SEPAERE---YLFVLEd---lEAKRLIG 70  Haliangium ...
WP_012234273       5 EIRAAVTGDEEQLLYVARHlnS----VNLPNNRDAIHEIVAESHRSFNGAI-QDPRLRQ---YVFVLVdltkgDKGMIVG 76  Sorangium c...
WP_015827400       3 IFRLATPADIDGLAALTSS--LGAGLTTVPRTPEKIAAYIDETQRFLS-------GDESanrIFFVVE-----MDGKVVG 68  Hirschia ba...
1YLE_A            76 CSAIVASAGFSE-PFYSFRNETFVHASRSLSIHNKIHVLSLCHDLTGNSLLTSFYVQRDLVQSV--YAELNSRGRLLFXA 152
WP_014437136      68 VSGLVRRVGTGE-PWYAYRLETRTVQSHALGFTRDIATLHLEARHHGPTEVGTLLLHPGARGSAagLGRLLSGCRYLFMR 146 Phycisphaer...
Q6MRF7            72 SSLVLAKHGNDEvPHSYFKIFKRDHFSQDLGVGFIHQVLRFQLDFDGPTEIGGLLVDKSYRRRPekLGKQISLSRFLYMG 151 Bdellovibri...
CBW28112          72 CSMIHAQHGTEDePHFFLTVSQENKFSESINTGFIHGTLKLGYDTDGPTEIGGLILDPNYRNNThkLGKQLSFVRFLYMA 151 Halobacteri...
Q1CYE6            72 TSMIIAQHGTYEaPHIYYEVSEREHYSASLSRHLRHKVLSIAYNYEGPTEVGGLVVDPPYRATPdkPGKQLSYGRFLFIA 151 Myxococcus ...
Q2IMC6            72 TSMIIAQHGTREsPCTFFDVSEREHYSSTIDRHFKHQVLSIGYHFDGPTEIGGLVVHPGQRGGEarAGKQLAFVRFLYMA 151 Anaeromyxob...
jgi:Anae109_0195  72 TSMVIAQHGTREsPCTFFDVSEREHYSSTIDRHFKHEVLSIGYHFDGPTEIGGLVVDPEERGGEerAGKQLAYVRFLYLA 151 Anaeromyxob...
jgi:Hoch_4839     71 TSIIHAQHGTRRsPHVYFEVLDDQRYSETLDSFFKHQGLRLGYDYDGPTEIGGLILLPDYRGHGerLGQFLSYVRFLFIA 150 Haliangium ...
WP_012234273      77 TSMIIAQLGRRGvPYIFFDVLDEEKYSATIDKHFHHTVLRIGYSYNGPTEIGGLVLMPEYRQGPerLGTMISYVRFLYMA 156 Sorangium c...
WP_015827400      69 MSAILPRLGRER-PYCSFKLSRHTRRSTTPSLKTAHDSLQFSTEFDGNTALATLFLSKEVRGGG--VGRLLSLGRLAFID 145 Hirschia ba...
1YLE_A           153 SHPERFADAVVVEIVGYSDEQGESPFWNAVGRNFFDLNYIEAEKLSgLKSRTFLAELMPHYPIYVPLLPDAAQESXGQVH 232
WP_014437136     147 RDLAGFADTTLAELRPPVRPDGGNAFWDAIGDRYFGLGYTAADRLS-ATDKRFIAELMPRQPIDVCLLSDEAQAVIGQVM 225 Phycisphaer...
Q6MRF7           152 LYPERFEDRVLCELTPPLTDEGRSEFWEALGRRFTGLPYQEADLLS-QSHKEFIESLFPQDDIYLCLLDAKARLVLGRVG 230 Bdellovibri...
CBW28112         152 LNKKRFKEMIHSELMPPFDKDGRSPLWEAIGRRFLNMEYHDADLLS-RSNKEFILSLYPSDTIYETLLPLEARNAIGKVG 230 Halobacteri...
Q1CYE6           152 MHRRLFRPRVLAELLPPLLPDGRSLLWEACGKKFTGLTYQEADRLS-RQNKEFIKELFPASDIYASLFPARVQKVLGEVG 230 Myxococcus ...
Q2IMC6           152 MFRDRFRERVLAELMPPLTKDGRSLFWEAFGKRFTDLDYQEADKKS-RENKEFIQQLFPPSDVYATLFSPAVRRLLGKVG 230 Anaeromyxob...
jgi:Anae109_0195 152 MFRERFREKVLAELMPPLTKDGRSAFWEAFGKRFTDLDYQTADKKS-RENKEFIQQLFPPVDVYATLFPEQVQRNLGKVG 230 Anaeromyxob...
jgi:Hoch_4839    151 MHREVFREEIHSELLPPLEPDGTSKLWEHLGRRFTGLGYQEADMLS-KYNKEFIRALFPHSIIYTSLFPQDVKALIGEVG 229 Haliangium ...
WP_012234273     157 ARSALFQDEILAELMPPLEPDGTSHLWEALGRKFTDMSYADADLLS-KKNKEFIKGLFPEGTIYASLLPEDAQRVIGKVG 235 Sorangium c...
WP_015827400     146 QHRDFFSKTLMADIRGWLDENGEAPFWNFIASKFIDLPFKEADELS-SEDGRFIAELIPSLPILLNLLPPETQDFIGRPH 224 Hirschia ba...
1YLE_A           233 PRAQITFDILXREGFETDNYIDIFDGGPTLHARTSGIRSIAQSRVVPVKi---GEAPKSGRPYLVTNGQLQ---DFRAVV 306
WP_014437136     226 PETLPARRMLEREGFAFADAVDIFDAGPVFSCATREIRSVRDAVERPVEa--aGPGGDAPPTHLVARASG----PFRCVL 299 Phycisphaer...
Q6MRF7           231 EATKPAQHLLESIGFSYLDEVDPFDGGPHYGANVSQILPITQGRRLRVTe---FKDAAYKEQGLVATTGE----DFKASL 303 Bdellovibri...
CBW28112         231 QDTQPVKRMLESIGFKYTKEVDPFDGGPHYRAKLGEIKPVQELKELELSfe-qDIKKDDALNYLVCPTEGD---VFNAIK 306 Halobacteri...
Q1CYE6           231 PQTRGVQRMLERIGFKYMERIDPFDGGPHFEADTADISLVRKFRTLKVAe---EDFDLEGDDVLVAAENDSgrnRFRAVR 307 Myxococcus ...
Q2IMC6           231 PDTEPVRRMLEKIGFRYVDRIDPFDGGPHYEATLAEITLVRAYRRARLApgplDAGLHGGEDCLIAVTRGEgrtRFRAVR 310 Anaeromyxob...
jgi:Anae109_0195 231 PETEPVRRMLERIGFHYVNRIDPFDGGPHYEARLEDVTLVRAYRRAKLAp---EPLERDGEERLVGRYRTGgkiRFRAVR 307 Anaeromyxob...
jgi:Hoch_4839    230 QPSRGVEKILRRIGFAYARHIDPFDGGPHFRCKTDEVSLIKNAVRVEVHt--vEGADTSRPVAMLAVEREQp--RFAAAC 305 Haliangium ...
WP_012234273     236 AQTRGVEKLLRRVGFRYAHRVDPFDGGPHFTARMDEISLVSDTRRAKAGr--pFTPSPSDPKGILAIERPDa-pYFRAVA 312 Sorangium c...
WP_015827400     225 RLSGKAMDLLMNAGFKKTDLCDVFDGGPAIECEISDTSIARTAVRTQTL-----DDDVEGDYSMLFSGHKT---DFRATI 296 Hirschia ba...
1YLE_A           307 LDLDWAPGKp-VALSVEAAEALGVGEGASVRLV 338
WP_014437136     300 AAAEVGDV---VRLPPAALDALQVSVGDAVHAT 329 Phycisphaera mikurensis
Q6MRF7           304 ASADVRGND--VALAPKVRQLLNIEVGEEIYMS 334 Bdellovibrio bacteriovorus
CBW28112         307 ITGKIKGAK--LLTSMKELENLNFTNKTKVNVI 337 Halobacteriovorax marinus SJ
Q1CYE6           308 CQARLENTQ--AFLPARAKEVLDIQAGAKVSII 338 Myxococcus xanthus DK 1622
Q2IMC6           311 AEARLDGTN--VWIPERAREVLEARPGERAHVV 341 Anaeromyxobacter dehalogenans 2CP-C
jgi:Anae109_0195 308 TPARLDGEV--LRIPAKARAILEASPGERLHLV 338 Anaeromyxobacter sp. Fw109-5
jgi:Hoch_4839    306 ARVIPLDDGnaLGITRAVQDTLGVSAGDSVWAt 338 Haliangium ochraceum DSM 14365
WP_012234273     313 ASLRDEGELg-MAIAVDAWKHLELQPRSPIWVL 344 Sorangium cellulosum
WP_015827400     297 AKADLRN----NVAPQSVANAFELSETAKLWIA 325 Hirschia baltica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap