Conserved Protein Domain Family
YHS

?
pfam04945: YHS 
YHS domain
This short presumed domain is about 50 amino acid residues long. It often contains two cysteines that may be functionally important. This domain is found in copper transporting ATPases, some phenol hydroxylases and in a set of uncharacterized membrane proteins. This domain is named after three of the most conserved amino acids it contains. The domain may be metal binding, possibly copper ions. This domain is duplicated in some copper transporting ATPases.
Statistics
?
PSSM-Id: 398552
Aligned: 12 rows
Threshold Bit Score: 48.5282
Threshold Setting Gi: 81859114
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9ZC53       408 VVDPVDKSHLtNQKSEYKYSYGGKTYFFSSEANYNRFRDHPEQFVTPV 455 Yersinia pestis
Q9HJ30         2 ATDPVCGMYV-PETSDLYVDRDGTRYYFCSKGCMDKFLEPEKEGKNLA 48  Thermoplasma acidophilum
WP_015006584  16 HKDPVCGMDVsKD-TQYQTEYKGQWYGFCCEGCLIKFNKDQDMYLSGq 62  Cycloclasticus sp. P1
Q9KLU4        38 VAYFTEGKPV-KGAAQFKTEYQGAEWLFASQQNLDAFLADPEKYAPQY 84  Vibrio cholerae
Q9CNI0       415 VIDPVDHSQLkNTRTEHKYSYEGKTYFFATEKNLHLFRDAPENYLNAE 462 Pasteurella multocida
O87082       403 IGSHWDRFHL----KPEQLVYKGRLYTFDSDVSKWIFELDPERYAGHT 446 Xanthobacter autotrophicus Py2
Q97YT0       197 IQAPANGKYL----RIYLKEYKGKMYTFDSPACLWIFEQEPERYAGRR 240 Saccharolobus solfataricus
WP_012839083 410 FTEPGDPTRI----CYRESDYEGSKYHFCSDGCKHVFDDEPEKFVQSW 453 Comamonas thiooxydans
Q0K3T5       407 fSEPDDPTQT----CYRESSYHGMKFHFCSDGCKDIFDDEPAKYAQAW 450 Cupriavidus necator H16
Q9HJ29         1 MIDPVCGMKVdKN-AKFKSTYNGKEYYFCSEHCKVEFDRNPIKY--TR 45  Thermoplasma acidophilum
Q9WYF0         3 VKDPVCGMKIeKEEAAEKIEYMGKEYYFCSQECAEKFKDNPEQYAHQK 50  Thermotoga maritima
Q9ZHC7        41 VRESVCGMVIlPDKAHSSIRYQDHQLYFCSASCESKFKAHPDHYFTEd 88  Salmonella enterica subsp. enterica serovar Typ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap